CMV-pp65 (495-503) HLA-A*02:01 流式验证

靶点说明

CMV病毒 pp65蛋白第495-503区域的多肽NLVPMVATV与HLA-A*02:01形成的复合物。该靶点具有明确活化T细胞的效应,已发布其结合的TCR序列。该靶点常被用于标准品,以测试抗原特异性活化T细胞的制备流程。由于CMV感染是血液肿瘤骨髓移植的主要防范目标,该靶点被用于检测血液肿瘤患者抗病毒免疫能力。

HLA类型

HLA-A*02:01, 中国人分布频率12.036%

抗原和HLA的亲和力

NetMHCpan 4.1  计算NLVPMVATV与HLA-A*02:01亲和力为17.92nM,肽与HLA稳定结合。

产品类型和应用

产品类型规格价格
流式检测与分选CMV-pp65 (495-503) HLA-A*02:01 PE / APC / Alexa Fluor 4887200元/50ug, 11800元/100ug
磁珠分选CMV-pp65 (495-503) HLA-A*02:01 磁珠8200元/50ug, 12800元/100ug
生物素化复合物CMV-pp65 (495-503) HLA-A*02:01-biotin6800元/50ug, 11400元/100ug

实测结果

实测1:肽刺激PBMC后检测抗原特异性CD8+T细胞

NLVPMVATV多肽刺激HLA-A*02:01限制性PBMC后,使用CMV-pp65 (495-503) HLA-A*02:01 PE 四聚体和抗CD8-FITC抗体检测。以未加抗原肽的细胞培养组为对照。

实测2:测试CMV-pp65 (495-503) HLA-A*02:01 PE/APC四聚体荧光标记细胞

针对NLVPMVATV多肽刺激后的HLA-A*02:01限制性PBMC,CMV-pp65 (495-503) HLA-A*02:01 PE四聚体和CMV-pp65 (495-503) HLA-A*02:01 APC四聚体同时标记抗原特异性T细胞。

靶点结合的TCR序列

T Cell Receptors - Group IDT Cell Receptors - Chain 1 CDR3T Cell Receptors - Chain 2 CDR3
823AVNYGNMLTASSKTSGSPYNEQF
825ILDNNNDMRASSLAPGATNEKLF
826AVFFGNVLHCASSRTGGAPEKLF
827AVGYGNQFYASIKTGGAPETQY
828AFPYNNNDMRASSLEGYTEAF
829AFPYNNNDMRASQIQGYTEAF
830ALGWANNLFASSPGTGHTGELF
832AVRDISARLMATAGTGGLF
833AFVTGNQFYASSPVTGTGTYGYT
834ILDRDGGGATNKLIATSPGLAGAYQETQY
835ALRDDKIIATSPGLAGAYQETQY
836VPPYEKLTASSLLVEQF
837VPPYEKLTVPPYEKLT
838AVVHNDMRASSQDVSRLAHLSTDTQN
839ATDGDDYKLSASSPGLAGGWEQY
840ATDGDDYKLSSARDNLRANYGYT
841AVSYGNMLTASNPVAGLPGEQY
1510ASGNNARLMASSEDHTGFYEQY
1521AFITGNQFYASSQTQLWETQY
1522ARNTGNQFYASSPQTGVGNYGYT
1523AVRDIIARLMASSSVNEQF
1538ATDAPGGYQKVTASSPWTGTLNTEA
1539AEISPSGGSYIPTATSDLKVHSGNYGYT
1540AERLQTGANNLFASSPPAGSYNEQ
1541APYTGTASKLTAWSSRGQMTDTQ
1542AVYGTASKLTSAFSGAAFVTDTQY
1543AARSNFGNEKLTASSAWDRSSGANVLT
1544AMRVPRAQGGSEKLVASSQDPFAVLNTEA
1627ARNTGNQASSYVTGTGSYGYTG
1628AYPYNNNDMRASSLEGYTEA
1629AEYTGTASKLTACSLRSQGTDTQY
1630AEYTGTASKLTAWSSRDSMTDTQY
1631AVDIETSGSRLTASSELGGAGTGEL
1632AVYFGNVLHCGASSFLQVTEA
1633AGPRQTSYDKVIASSSANYGYT
1634AGPRKTSYDKVIASSSANYGYT
1635AGPMKTSYDKVIASSSAHYGYT
1636AGPMKTSYDKVIASSSAFYGYT
1637AGPEKTSYDKVIASSSANYGYT
1638ATKNTGNQFYASSVGLPYEQY
1639AFIAGNQFYASSLFVGGPGNEQ
1640AVAFGNQFYASTGTSGALYNEQ
1641ARNTGNQFYASSETGATNYGYTG
1642ARNTGNQFYASSYQTGAGGYGYTG
1643ARNTGNQFYASSPVTGGIYGYTG
1644ARNTGNQFYASSFQTGASYGYTFG
1645ILLGTGANNLFASSPKLQGAWAEKL
1646AKNTGNQFYASSPQTGTIYGYTG
1647AFPYNNNDMRASSLEGYTEAFFG
1648ILDNNNDMRFGASSLAPGATNEKL
1649AGNTGNQFYFGASSLQTGATFNYGYT
1650ILSPNNDMRFGAWSVSDLAKNIQY
1651ILPLWLTFGASSLEGYTEAFFG
1652ARQDGNQFYASSPVAGGAYNEQ
1653AVRIDYKLSASSYSTGAGETQY
1654AVYYGQNFVASSFQGYTEA
1163ARNTGNQFYASSPVTGGIYGYT
824ILDNNNDMRASSLAPGTTNEKLF
1970ARNTGNQFYFGASSETGATNYGYTG
1971ARNTGNQFYFGASSYVTGTGSYGYTG
1972ARNTGNQFYFGASSPVTGGIYGYTG
1973ARNTGNQFYFGASSYQTGAGGYGYTFG
1974AYPYNNNDMRFGASSLEGYTEAFFG
1975AEYTGTASKLTFGACSLRSQGTDTQYFG
1976AEYTGTASKLTFGAWSSRDSMTDTQYFG
1977AVDIETSGSRLTFGASSELGGAGTGELFFG
1978AVYFGNVLHCGASSFLQVTEAFFG
1979AGPRQTSYDKVIFGASSSANYGYTFG
1980AGPRKTSYDKVIFGASSSANYGYTFG
1981AGPMKTSYDKVIFGASSSAHYGYTFG
1982AGPMKTSYDKVIFGASSSAFYGYTFG
1983AGPEKTSYDKVIFGASSSANYGYTFG
1984AVYGTASKLTFGSAFSGAAFVTDTQYFG
1985AEISPSGGSYIPTFGATSDLKVHSGNYGYTFG
1986ATKNTGNQFYFGASSVGLPYEQYEQ
1987AFIAGNQFYFGASSLFVGGPGNEQFFG
1988AVAFGNQFYFGASTGTSGALYNEQFFG
1989AERLQTGANNLFFGASSPPAGSYNEQFFG
1990ILLGTGANNLFFGASSPKLQGAWAEKLFFG
1991AMRVPRAQGGSEKLVFGASSQDPFAVLNTEAFFG
1992APYTGTASKLTFGAWSSRGQMTDTQYFG
1993AKNTGNQFYFGASSPQTGTIYGYTG
1994AFPYNNNDMRFGASSLEGYTEAFFG
1995ILDNNNDMRFGASSLAPGATNEKLFFG
1996AGNTGNQFYFGASSLQTGATFNYGYTFG
1997ILSPNNDMRFGAWSVSDLAKNIQYFG
1998AARSNFGNEKLTFGASSAWDRSSGANVLTFG
1999ARQDGNQFYFGASSPVAGGAYNEQFFG
2000AVRIDYKLSFGASSYSTGAGETQYFG
2001AVYYGQNFVFGASSFQGYTEAFFG
2002ATDAPGGYQKVTFGASSPWTGTLNTEAFFG
18544AFITGNQFYASSQTQLWETQY
18545ILDNNNDMRASSLAPGTTNEKLF
20507CARNTGNQFYFCAWSISDLAKNIQYF
20508CARNTGNQFYFCASSAQTGASYGYTF
20509CARNTGNQFYFCASSPSTGVTFYGYTF
20510CARNTGNQFYFCASSWKTGTGGTGYTF
20511CARNTGNQFYFCASSYQTGTGVYGYTF
20538CAGPMKTSYDKVIFCASASANYGYTF
20713CAAPGAGSYQLTFCASTLWSATNEKLFF
20714CAASDSNYQLIWCASSEESGRAAEQYF
20715CAASESGGSNYKLTFCASSGRWTAYNEQFF
20716CAASGGNNNDMRFCASSVTPSSYNEQFF
20717CAATDNARLMFCATSRDLAEVNTEAFF
20718CAEIPNYGGSQGNLIFCASSFIGGVDGYTF
20719CAEIQASGGSYIPTFCATGRGGKIGEQYF
20720CAEIQASGGSYIPTFCATGRGGMIGEQYF
20721CAEITGGGNKLTFCSATDVTKGQLISGYTF
20722CAENNSGDSSYKLIFCASSFAHLSYNEQFF
20723CAETPGPSYDKVIFCAWSISDLAKNIQYF
20724CAETRSRDYKLSFCASSQEEGPGNQPQHF
20725CAFELILGAQKLVFCASSYSWTGSNYGYTF
20726CAFPYNNNDMRFCASSLEGYTEAFF
20727CAGDNNARLMFCASSSDPSGGGYNEQFF
20728CAGKTSYDKVIFCATEQGMHEQYF
20729CAGPRETSYDKVIFCASASANYGYTF
20730CAGPRETSYDKVIFCASSSAYYGYTF
20731CAGQASQGNLIFCASSIQALLTF
20732CAGSGTASKLTFCASGEGGELFF
20733CAHLGGSSNTGKLIFCAVNGGSNYGYTF
20734CAIDTGGFKTIFCASSGTDSNQPQHF
20735CALSDAYNFNKFYFCASSDDRVRYGYTF
20736CALSDVGMNRDDKIIFCASSQGLGREGASEQFF
20737CALSGDDYKLSFCASSVASGRAHEQYF
20738CASSSVNEQYFCASSPITGTGAYGYTF
20739CATDAPSNYQLIWCASSSSGRDYEQYF
20740CAVADTGNQFYFCATAITSTQYF
20741CAVAFGNQFYFCASSMTSGALYNEQFF
20742CAVAFGNQLYFCASSMTSGALYNEQFF
20743CAVEDYGQNFVFCSARDRNTQGPETQYF
20744CAVNAAGNDYKLSFCASSTRTGQETQYF
20745CAVRATDSSYKLIFCASSFPKDGSTYEQYF
20746CAVRDNFITGGFKTIFCASSYFDEKLFF
20747CAVRDNQAGTALIFCASSAGSGSGYNEQFF
20748CAVRDNSITGGFKTIFCASSYFDEKLFF
20749CAVRDSNYQLIWCASSDAENTEAFF
20750CAVRDSNYQLIWCASSKGEVTEAFF
20751CAVREDNAGNMLTFCASGPLLLMTNEQFF
20752CAVREGGQKLLFCATSDRTSATEAFF
20753CAVRNNNARLMFCASSIVNEAFF
20754CAVRNNNARLMFCASSVVNEAFF
20755CAVRPGYSSASKIIFCASSETSGRSPYEQYF
20756CAVRQDYQLIWCASGPGTSATDTQYF
20757CAVRQGYQLIWCASGPGTSATDTQYF
20758CAVRSWSTDKLIFCASSVEGTSGRSYNEQFF
20759CAVRVLMEYGNKLVFCASSPGLASPYSYNEQFF
20760CAVSGSYNTDKLIFCSARDGLAGHYEQYF
20761CAVSGSYNTDKLIFCSARDGLTGHYEQYF
20762CAVTPPPSYDKVIFCASSSVSGYTF
20763CAVVDQAGTALIFCASSAGGGSYNEQFF
20764CILSNNNDMCFCAWSISDLAKNIQYF
20765CILSNNNDMRFCAWSISDLAKNIQYF
20766CILSNNNDMRFCASSPSTGVTFYGYTF
20767CILSNNNDMRFCAWSVSDVANTEAFF
20768CILSNNNDMRFCSAPPAGEYSNQPQHF
20769CILSNNNDMRFCSARDPSGLAGGLAETQYF
20770CLVGGIGFGNVLHCCAWSISDLAKNIQYF
20771CVVSENYGGSQGNLIFCASSLPPGRGYTEAFF
20772CVVSRRTTGANNLFFCASSYTLASYEQYF
20773CAGAGSEGSGAGSYQLTFCATSRPTVGSRLRDGYTF
20774CILPLAGGTSYGKLTFCAWSVADTQYF
20775CILPLAGGTSYGKLTFCSVEYRDNEQFF
20776CILPLAGGTSYGKLTFCAISESYEQYF
20779CAASINRMDNDMRFCSAFDREGVDGYTF
20780CALSEAGGYSTLTFCSAKVEGYEQYF
20781CAHYYGNNRLAFCSAPPDSLNTEAFF
20782CGADPEGDDKIIFCSARAEGARDSPLHF
20783CIVRVGAAGNKLTFCSARDVPGTTLGGELFF
20784CAVRDLNARLMFCSAREEGTQAWETQYF
20785CAVRDLNARLMFCASSSVNEQYF
20786CAVRDQEGNTPLVFCSAREEGTQAWETQYF
20787CAVRDQEGNTPLVFCAISAGTGVRNEQYF
20788CAVRDQEGNTPLVFCASMGGSNEQFF
20789CAVRDQEGNTPLVFCASSSVNEQYF
20790CAVRDQEGNTPLVFCASSYSRSDGHLGNTIYF
20792CVVNDGQNFVFCSARRTGSTYNEQFF
20793CAVKGAGSYQLTFCSARYGSTCEQYF
20794CAVRFLTDSWGKLQFCSATTESNQPQHF
20795CAVRFLTDSWGKLQFCASSQRMGLSETQYF
20796CAVDKDGGATNKLIFCSDGQAFF
20797CVVSARNTGNQFYFCSVGLAGSYNEQFF
20798CVVSAGSIVSGGYNKLIFCAIRDKMNTEAFF
20799CAVRGRSNYGGSQGNLICASRDTSGTAYEQYF
20800CAVSEGVVWDLYGGSQGNLIFCASREDGTEAFF
20801CALSDGYSGGGADGLTFCASRPDGRETQYF
20802CAVRDSNYQLIWCASSDRETYEQYF
20803CALSGEGGSEKLVFCASSETGFGNQPQHF
20804CAVTYSGAGSYQLTFCASSFLQGNQPQHF
20807CAVRRAGNDMRFCASSGTNSPLHF
20808CILDNNNDMRFCASSLAPGATNEKLFF
20809CIRDNNNDMRFCASSLAPGATNEKLFF
20810CIKDNNNDMRFCASSLAPGTTNEKLFF
20811CILIPTGTYKYIFCASSLEGFTEAFF
20812CAPGNTGKLIFCASSLGRDLNQPQHF
20813CAGQLWTGTASKLTFCASSLGRGIYEQYF
20814CVVVAYSGAGSYQLTFCASSLTGTTYGGYTF
20815CAGRNNNARLMFCASSLVGSGGEQYF
20816CAVNSGYSTLTFCASSPGQGGDEQYF
20817CALSEGVFNDYKLSFCASSPRQSNQPQHF
20818CAASRSNSGYALNFCASSQDISRGQTLFGNSPLHF
20819CVVSEWAAGNKLTFCASSQEQGDIQYF
20820CALSEANQAGTALIFCASSQERGGKWAYEQYF
20821CALSDRNQGGKLIFCASSQGKDTQYF
20822CALSGQGGSEKLVFCASSQTGFGNQPQHF
20823CAVEQGFNKFYFCASSRLGDGDSNQPQHF
20824CAARTRGSTLGRLYFCASSSANYGYTF
20825CATWNSWGKFQFCASSSETTSPLHF
20826CAVRDYGSGGYNKLIFCASSSRTSGINEQFF
20827CAVMTTDSWGKLQFCASSTPGAKLGDTGELFF
20828CAVSNNNDMRFCASSVVERAFF
20829CAMREVFNDYKLSFCASSVVERAFF
20830CAVRDISARLMFCASSVVERAFF
20831CAVRGQTGFQKLVFCASSYFRDRVGDQPQHF
20832CAVMDSNYQLIWCASSYSSSTGELFF
25125CADYYGQNFVFGCASSFQGYTEAFFG
25126CASNTGNQFYFGCASSPVTGTGHYGYTFG
26540CAMNGARLMFGDCSARDVLAGGSDTQYFG
26541CARNTGNQFYFGTCASSSVTGTGNYGYTFG
26542CAFNFGNEKLTFGTCASSLFGGFTEAFFG
26543CAVRSNFGNEKLTFGTCASSFWDRVSGANVLTFG
26969AFPINHSGGSNYKLTASSSTNGYT
26970ARNTGNQFYASSLVTGTGWGYT
26971ASNTGNQFYASSPITGTGIYGYT
26972ILGWGKLQASSLDRVTGECF
26973ILGWGKLQASSLDRVTGELF
27759CADYYGQNFVFCASSFQGYTEAFF
27760CAGPMKTSYDKVIFCASSSANYGYTF
27761CARNTGNQFYFCASSYSTGTAYGYTF
27812CATNTGNQFYFCASSPTTRTRYYGYTF
27813CAAPRETSYDKVIFCASSSANYGYTF
27814CAGPTKTSYDKVIFCASSSANYGYTF
27815CAVNYGNMLTFCASSYATEVAGETQYF
27816CAVFYGNKLVFCASSYATGIPDTQYF
27817CILSNNNDMRFCAWSISDSSRVEAFF
30282CAGPMKTSYDKVIFGCASSSANYGYTFG
30283CAVFFGCASSPTGGSPSPLHFG
34640CAVNDRGSTLGRLYFCSVWSFGDRDGYTF
34641CAVNDRGSTLGRLYFCASSSANYGYTF
34642CAVNDRGSTLGRLYFCASSSSPGLDNEQFF
34643CAVNDRGSTLGRLYFCASSYITGTGSYGYTF
34644CAVNFGGGKLIFCASSSANYGYTF
34645CPREEGGSQGNLIFCASSSANYGYTF
34646CTSPNTNAGKSTFCSARDRIGNTIYF
45963CAVWMDSSYKLIFASSQEAADNEKLF
59000CAVRGTNARLMFASSSVNEAF
59001CAVRNNNARLMFASSIVNEAF
181933CILDNNNDMRFCASSLAPGTTNEKLFF
182875CARNTGNQFYFCASSPVTGGIYGYTF
185996ILDNNNDMRASSLAPGATNEKLF
185997ILSNNNDMRAWTISDLAKNIQY
185998AASGGPSYDKVIASSPGNILGGYT
188864CAGYYGQNFVFCASSFQGYTEAFF
188865CARNTGNQFYFCASSFQTGTGTYGYTF
188866CTRGSQGNLIFCASSFQTGTGTYGYTF
189729CASGNAGNMLTFCASSPGTGAVFFYGYTF
189811CAVNYGNKLVFCASSPFSGAPYEQYF
190022CASQTGDSWGKFQFCASSQEFPGQGSYEQYF
190232CAEIPPNSGNTPLVFCSADPGQGLGYGYTF
190378CALSENTDKLIFCSARAELAADFISSYNEQFF
190421CAGGGSSNTGKLIFCASTPFASTEAFF
190760CVVNPTGGFQKLVFCASSYFSGPYEQYF
190777CAVGSQGNLIFCATSDPLAAAYEQYF
191008CAVRDVSARLMFCASSSVNEQYF
191011CAVRDISARLMFCASSSVTEAFF
198235CACPPGDYKLSFCASSLDIPSYNEQFF
201202CAATNAGGTSYGKLTFCASSYFGSHDEQFF
201203CAEYTGTASKLTFCAWSSRGAMTDTQYF
201205CAFPYNNNDMRFCASSLEGYTEAFF
201206CAFPYNNNDMRFCASRTTTGVRTDTQYF
201211CARNTGNQFYFCASRGGGTQPWOEQFF
201217CAVNGAGSYQLTFCATSTETGEAFF
201286EGGNQFRLLAGGRSAQ
201287EPENSGGSNYKLSSANYGY
201289IAGNQFSLLLGTAAEA
201335KNFNKFSVYGGAGNSPL
201351NTGNQFSLVSGSGSYGY
201352NTGNQFSPTTGTGYFGY
201353NTGNQFSRQTGAAYGY
201354NTGNQFSYATGTAYGY
201355PMKTSYDKVSVVGLWTDTQ
201357PRETSYDKVSSANYGY
201358REGIIQGAQKLSPLGGAGLADTQ
201373YYGQNFSFLGYTEA
204876CAGPLKTSYDKVIFASSSAHYGYT
204993CILDNNNDMRFASSLAPGATNEKLF
204994CIRDNNNDMRFASSLAPGATNEKLF
205632CAVVLREYGNKLVFSVGDGRGGEQY

数据来源:IEDB数据库

相关文章

Reference - PMIDReference - AuthorsReference - JournalReference - DateReference - Title
15096491Giuseppina Li Pira; Laura Bottone; Federico Ivaldi; Roberta Pelizzoli; Francesco Del Galdo; Luisa Lozzi; Luisa Bracci; Arianna Loregian; Giorgio Palù; Raffaele De Palma; Hermann Einsele; Fabrizio MancaInt Immunol2004Identification of new Th peptides from the cytomegalovirus protein pp65 to design a peptide library for generation of CD4 T cell lines for cellular immunoreconstitution.
15585874Naeem Khan; Andrew Hislop; Nancy Gudgeon; Mark Cobbold; Rajiv Khanna; Laxman Nayak; Alan B Rickinson; Paul A H MossJ Immunol2004Herpesvirus-specific CD8 T cell immunity in old age: cytomegalovirus impairs the response to a coresident EBV infection.
15556681Brigitte Godard; Agnès Gazagne; Alain Gey; Muriel Baptiste; Benoit Vingert; Beatrice Pegaz-Fiornet; Laurence Strompf; Wolf H Fridman; Denis Glotz; Eric TartourHum Immunol2004Optimization of an elispot assay to detect cytomegalovirus-specific CD8+ T lymphocytes.
15050296Qin Ouyang; Wolfgang M Wagner; Wei Zheng; Anders Wikby; Ed J Remarque; Graham PawelecExp Gerontol2004Dysfunctional CMV-specific CD8(+) T cells accumulate in the elderly.
15514011Deepa Trivedi; Roxanne Y Williams; Richard J O'Reilly; Guenther KoehneBlood2005Generation of CMV-specific T lymphocytes using protein-spanning pools of pp65-derived overlapping pentadecapeptides for adoptive immunotherapy.
11792386Jeffrey R Currier; Ellen G Kuta; Ellen Turk; Lyndsay B Earhart; Larry Loomis-Price; Sylvia Janetzki; Guido Ferrari; Deborah L Birx; Josephine H CoxJ Immunol Methods2002A panel of MHC class I restricted viral peptides for use as a quality control for vaccine trial ELISPOT assays.
12594271Eugene V Ravkov; Christy M Myrick; John D AltmanJ Immunol2003Immediate early effector functions of virus-specific CD8+CCR7+ memory cells in humans defined by HLA and CC chemokine ligand 19 tetramers.
11687239G T Brice; N L Graber; S L Hoffman; D L DoolanJ Immunol Methods2001Expression of the chemokine MIG is a sensitive and predictive marker for antigen-specific, genetically restricted IFN-gamma production and IFN-gamma-secreting cells.
10553078A Solache; C L Morgan; A I Dodi; C Morte; I Scott; C Baboonian; B Zal; J Goldman; J E Grundy; J A MadrigalJ Immunol1999Identification of three HLA-A*0201-restricted cytotoxic T cell epitopes in the cytomegalovirus protein pp65 that are conserved between eight strains of the virus.
11160752J A Zaia; G Gallez-Hawkins; X Li; Z Q Yao; N Lomeli; K Molinder; C La Rosa; D J DiamondJ Virol2001Infrequent occurrence of natural mutations in the pp65(495-503) epitope sequence presented by the HLA A*0201 allele among human cytomegalovirus isolates.
11986243Holger Hebart; Senay Daginik; Stefan Stevanovic; Ulrich Grigoleit; Andrea Dobler; Manuela Baur; Georg Rauser; Christian Sinzger; Gerhard Jahn; Juergen Loeffler; Lothar Kanz; Hans-Georg Rammensee; Hermann EinseleBlood2002Sensitive detection of human cytomegalovirus peptide-specific cytotoxic T-lymphocyte responses by interferon-gamma-enzyme-linked immunospot assay and flow cytometry in healthy individuals and in patients after allogeneic stem cell transplantation.
9971792M P Weekes; M R Wills; K Mynard; A J Carmichael; J G SissonsJ Virol1999The memory cytotoxic T-lymphocyte (CTL) response to human cytomegalovirus infection contains individual peptide-specific CTL clones that have undergone extensive expansion in vivo.
11237798A F Hassan-Walker; A L Vargas Cuero; F M Mattes; P Klenerman; F Lechner; A K Burroughs; P D Griffiths; R E Phillips; V C EmeryJ Infect Dis2001CD8+ cytotoxic lymphocyte responses against cytomegalovirus after liver transplantation: correlation with time from transplant to receipt of tacrolimus.
11390521M J Pittet; A Zippelius; D E Speiser; M Assenmacher; P Guillaume; D Valmori; D Liénard; F Lejeune; J C Cerottini; P RomeroJ Immunol2001Ex vivo IFN-gamma secretion by circulating CD8 T lymphocytes: implications of a novel approach for T cell monitoring in infectious and malignant diseases.
11689620H Wedemeyer; E Mizukoshi; A R Davis; J R Bennink; B RehermannJ Virol2001Cross-reactivity between hepatitis C virus and Influenza A virus determinant-specific cytotoxic T cells.
16301748Godelieve J de Bree; Ester M M van Leeuwen; Theo A Out; Henk M Jansen; René E Jonkers; René A W van LierJ Exp Med2005Selective accumulation of differentiated CD8+ T cells specific for respiratory viruses in the human lung.
16462803Mireille Toebes; Miriam Coccoris; Adriaan Bins; Boris Rodenko; Raquel Gomez; Nella J Nieuwkoop; Willeke van de Kasteele; Guus F Rimmelzwaan; John B A G Haanen; Huib Ovaa; Ton N M SchumacherNat Med2006Design and use of conditional MHC class I ligands.
15919939Simon M Rushbrook; Scott M Ward; Esther Unitt; Sarah L Vowler; Michaela Lucas; Paul Klenerman; Graeme J M AlexanderJ Virol2005Regulatory T cells suppress in vitro proliferation of virus-specific CD8+ T cells during persistent hepatitis C virus infection.
14980436Patrick A Ott; Beate R Berner; Bernhard A Herzog; Robert Guerkov; Nicole L Yonkers; Ivana Durinovic-Bello; Magdalena Tary-Lehmann; Paul V Lehmann; Donald D AnthonyJ Immunol Methods2004CD28 costimulation enhances the sensitivity of the ELISPOT assay for detection of antigen-specific memory effector CD4 and CD8 cell populations in human diseases.
11270597X S He; B Rehermann; J Boisvert; J Mumm; H T Maecker; M Roederer; T L Wright; V C Maino; M M Davis; H B GreenbergViral Immunol2001Direct functional analysis of epitope-specific CD8+ T cells in peripheral blood.
16156661Rico Buchli; Rodney S VanGundy; Heather D Hickman-Miller; Christopher F Giberson; Wilfried Bardet; William H HildebrandBiochemistry2005Development and validation of a fluorescence polarization-based competitive peptide-binding assay for HLA-A*0201--a new tool for epitope discovery.
17109345Jonas Soderholm; Matti SallbergJ Infect Dis2006A complete mutational fitness map of the hepatitis C virus nonstructural 3 protease: relation to recognition by cytotoxic T lymphocytes.
9292508D J Diamond; J York; J Y Sun; C L Wright; S J FormanBlood1997Development of a candidate HLA A*0201 restricted peptide-based vaccine against human cytomegalovirus infection.
11756174Karl Peggs; Stephanie Verfuerth; Arnold Pizzey; Jenni Ainsworth; Paul Moss; Stephen MackinnonBlood2002Characterization of human cytomegalovirus peptide-specific CD8(+) T-cell repertoire diversity following in vitro restimulation by antigen-pulsed dendritic cells.
11703346R D Keenan; J Ainsworth; N Khan; R Bruton; M Cobbold; M Assenmacher; D W Milligan; P A MossBr J Haematol2001Purification of cytomegalovirus-specific CD8 T cells from peripheral blood using HLA-peptide tetramers.
11520783J W Gratama; J W van Esser; C H Lamers; C Tournay; B Löwenberg; R L Bolhuis; J J CornelissenBlood2001Tetramer-based quantification of cytomegalovirus (CMV)-specific CD8+ T lymphocytes in T-cell-depleted stem cell grafts and after transplantation may identify patients at risk for progressive CMV infection.
11470284H T Maecker; H S Dunn; M A Suni; E Khatamzas; C J Pitcher; T Bunde; N Persaud; W Trigona; T M Fu; E Sinclair; B M Bredt; J M McCune; V C Maino; F Kern; L J PickerJ Immunol Methods2001Use of overlapping peptide mixtures as antigens for cytokine flow cytometry.
11468143S Szmania; A Galloway; M Bruorton; P Musk; G Aubert; A Arthur; H Pyle; N Hensel; N Ta; L Lamb Jr; T Dodi; A Madrigal; J Barrett; J Henslee-Downey; F van RheeBlood2001Isolation and expansion of cytomegalovirus-specific cytotoxic T lymphocytes to clinical scale from a single blood draw using dendritic cells and HLA-tetramers.
11328306A Kleihauer; U Grigoleit; H Hebart; A Moris; P Brossart; A Muhm; S Stevanovic; H G Rammensee; C Sinzger; S Riegler; G Jahn; L Kanz; H EinseleBr J Haematol2001Ex vivo generation of human cytomegalovirus-specific cytotoxic T cells by peptide-pulsed dendritic cells.
11220618J Longmate; J York; C La Rosa; R Krishnan; M Zhang; D Senitzer; D J DiamondImmunogenetics2001Population coverage by HLA class-I restricted cytotoxic T-lymphocyte epitopes.
10954891B L Shacklett; T J Beadle; P A Pacheco; J H Grendell; P A Haslett; A S King; G S Ogg; P M Basuk; D F NixonAIDS Res Hum Retroviruses2000Isolation of cytomegalovirus-specific cytotoxic T-lymphocytes from gut-associated lymphoid tissue (GALT) of HIV type 1-infected subjects.
10933725G M Gillespie; M R Wills; V Appay; C O'Callaghan; M Murphy; N Smith; P Sissons; S Rowland-Jones; J I Bell; P A MossJ Virol2000Functional heterogeneity and high frequencies of cytomegalovirus-specific CD8(+) T lymphocytes in healthy seropositive donors.
10868621M Engstrand; C Tournay; M A Peyrat; B M Eriksson; J Wadström; B Z Wirgart; F Romagné; M Bonneville; T H Tötterman; O KorsgrenTransplantation2000Characterization of CMVpp65-specific CD8+ T lymphocytes using MHC tetramers in kidney transplant patients and healthy participants.
10608763X Jin; M A Demoitie; S M Donahoe; G S Ogg; S Bonhoeffer; W M Kakimoto; G Gillespie; P A Moss; W Dyer; M G Kurilla; S R Riddell; J Downie; J S Sullivan; A J McMichael; C Workman; D F NixonJ Infect Dis2000High frequency of cytomegalovirus-specific cytotoxic T-effector cells in HLA-A*0201-positive subjects during multiple viral coinfections.
10583606M P Weekes; M R Wills; K Mynard; R Hicks; J G Sissons; A J CarmichaelImmunology1999Large clonal expansions of human virus-specific memory cytotoxic T lymphocytes within the CD57+ CD28- CD8+ T-cell population.
10358214M P Weekes; A J Carmichael; M R Wills; K Mynard; J G SissonsJ Immunol1999Human CD28-CD8+ T cells contain greatly expanded functional virus-specific memory CTL clones.
17391521Stefanie L Slezak; Maria Bettinotti; Silvia Selleri; Sharon Adams; Francesco M Marincola; David F StroncekJ Transl Med2007CMV pp65 and IE-1 T cell epitopes recognized by healthy subjects.
17063516Haruki Komatsu; Kazuhiro Kogawa; Shigeaki Nonoyama; Ayno Inui; Tsuyoshi Sogo; Tomoo Fujisawa; Paul KlenermanJ Med Virol2006Bone marrow transplantation from a pediatric donor with a high frequency of cytomegalovirus-specific T-cells.
16850281Xian-Hui He; Qing-Bing Zha; Yi Liu; Li-Hui Xu; Xiao-Yun ChiJ Clin Immunol2006High frequencies cytomegalovirus pp65(495-503)-specific CD8+ T cells in healthy young and elderly Chinese donors: characterization of their phenotypes and TCR Vbeta usage.
16840731Ester M M van Leeuwen; Ester B M Remmerswaal; Mirjam H M Heemskerk; Ineke J M ten Berge; Rene A W van LierBlood2006Strong selection of virus-specific cytotoxic CD4+ T-cell clones during primary human cytomegalovirus infection.
16553554Sandra Pepperl-Klindworth; Katrin Besold; Nadine Frankenberg; Mildred Farkas; Jürgen Kuball; Matthias Theobald; Bodo PlachterViral Immunol2006Cytomegalovirus interleukin-10 expression in infected cells does not impair MHC class I restricted peptide presentation on bystanding antigen-presenting cells.
16516226Pascal Batard; Daniel A Peterson; Estelle Devêvre; Philippe Guillaume; Jean-Charles Cerottini; Donata Rimoldi; Daniel E Speiser; Lars Winther; Pedro RomeroJ Immunol Methods2006Dextramers: new generation of fluorescent MHC class I/peptide multimers for visualization of antigen-specific CD8+ T cells.
16474394Hilary L Hoare; Lucy C Sullivan; Gabriella Pietra; Craig S Clements; Eleanor J Lee; Lauren K Ely; Travis Beddoe; Michela Falco; Lars Kjer-Nielsen; Hugh H Reid; James McCluskey; Lorenzo Moretta; Jamie Rossjohn; Andrew G BrooksNat Immunol2006Structural basis for a major histocompatibility complex class Ib-restricted T cell response.
16336973Jörg Chromik; Elke Schnürer; Ralf Georg Meyer; Thomas Wehler; Thomas Tüting; Thomas Wölfel; Christoph Huber; Wolfgang HerrJ Immunol Methods2006Proteasome-inhibited dendritic cells demonstrate improved presentation of exogenous synthetic and natural HLA-class I peptide epitopes.
16281937Mutsuko Ohnishi; Toshiharu Sakurai; Yuji Heike; Rie Yamazaki; Yoshinobu Kanda; Yoichi Takaue; Hideaki Mizoguchi; Yutaka KawakamiBr J Haematol2005Evaluation of cytomegalovirus-specific T-cell reconstitution in patients after various allogeneic haematopoietic stem cell transplantation using interferon-gamma-enzyme-linked immunospot and human leucocyte antigen tetramer assays with an immunodominant T-cell epitope.
16275592Ghislaine Gallez-Hawkins; Lia Thao; Simon F Lacey; Joybelle Martinez; Xiuli Li; Anne E Franck; Norma A Lomeli; Jeff Longmate; Don J Diamond; Ricardo Spielberger; Stephen J Forman; John A ZaiaBiol Blood Marrow Transplant2005Cytomegalovirus immune reconstitution occurs in recipients of allogeneic hematopoietic cell transplants irrespective of detectable cytomegalovirus infection.
16212532A L Bissinger; J Brugger; G U Grigoleit; C Gründemann; H Hebart; H Einsele; G JahnViral Immunol2005Visualization and microscopic quantification of HCMV-peptide-specific cytotoxic T lymphocytes using tetramer binding.
16160916Anna K Lidehall; Fredrik Sund; Tobias Lundberg; Britt-Marie Eriksson; Thomas H Tötterman; Olle KorsgrenJ Clin Immunol2005T cell control of primary and latent cytomegalovirus infections in healthy subjects.
16113668Y Morita; M Hosokawa; M Ebisawa; T Sugita; O Miura; Y Takaue; Y HeikeBone Marrow Transplant2005Evaluation of cytomegalovirus-specific cytotoxic T-lymphocytes in patients with the HLA-A*02 or HLA-A*24 phenotype undergoing hematopoietic stem cell transplantation.
15971271Martina Wiesner; Caroline Zentz; Markus H Hammer; Mark Cobbold; Florian Kern; Hans-Jochem Kolb; Wolfgang Hammerschmidt; Reinhard Zeidler; Andreas MoosmannEur J Immunol2005Selection of CMV-specific CD8+ and CD4+ T cells by mini-EBV-transformed B cell lines.
15802973Shelley F Stone; Patricia Price; Naeem Khan; Paul A Moss; Martyn A FrenchAIDS2005HIV patients on antiretroviral therapy have high frequencies of CD8 T cells specific for Immediate Early protein-1 of cytomegalovirus.
15717275Simon F Lacey; Joy Martinez; Ghislaine Gallez-Hawkins; Lia Thao; Jeff Longmate; Wahajul Haq; Ricardo Spielberger; Stephen J Forman; John A Zaia; Don J DiamondJ Infect Dis2005Simultaneous reconstitution of multiple cytomegalovirus-specific CD8+ cell populations with divergent functionality in hematopoietic stem-cell transplant recipients.
15287944Arnon P Kater; Ester B M Remmerswaal; Martijn A Nolte; Eric Eldering; Marinus H J van Oers; René A W van LierBr J Haematol2004Autologous cytomegalovirus-specific T cells as effector cells in immunotherapy of B cell chronic lymphocytic leukaemia.
14550813Holger Hebart; Georg Rauser; Stefan Stevanovic; Claire Haenle; Alexander K Nussbaum; Christoph Meisner; Alfred L Bissinger; Stefan Tenzer; Gerhard Jahn; Juergen Loeffler; Hans-Georg Rammensee; Hansjörg Schild; Hermann EinseleExp Hematol2003A CTL epitope from human cytomegalovirus IE1 defined by combining prediction of HLA binding and proteasomal processing is the target of dominant immune responses in patients after allogeneic stem cell transplantation.
12974748H Komatsu; S Sierro; A V Cuero; P KlenermanClin Exp Immunol2003Population analysis of antiviral T cell responses using MHC class I-peptide tetramers.
12964124Maria C Villacres; Simon F Lacey; Catherine Auge; Jeff Longmate; John M Leedom; Don J DiamondJ Infect Dis2003Relevance of peptide avidity to the T cell receptor for cytomegalovirus-specific ex vivo CD8 T cell cytotoxicity.
12763937Persis J Amrolia; Giada Muccioli-Casadei; Eric Yvon; Helen Huls; Uluhan Sili; Eric D Wieder; Catherine Bollard; Jaroslav Michalek; Victor Ghetie; Helen E Heslop; Jeffrey J Molldrem; Cliona M Rooney; John Schlinder; Ellen Vitetta; Malcolm K BrennerBlood2003Selective depletion of donor alloreactive T cells without loss of antiviral or antileukemic responses.
12716365Björn Carlsson; Wing-Shing Cheng; Thomas H Tötterman; Magnus EssandBr J Haematol2003Ex vivo stimulation of cytomegalovirus (CMV)-specific T cells using CMV pp65-modified dendritic cells as stimulators.
12692225Rebecca Elkington; Susan Walker; Tania Crough; Moira Menzies; Judy Tellam; Mandvi Bharadwaj; Rajiv KhannaJ Virol2003Ex vivo profiling of CD8+-T-cell responses to human cytomegalovirus reveals broad and multispecific reactivities in healthy virus carriers.
12689926Wendelina J M Mackus; Florine N J Frakking; Annette Grummels; Laila E Gamadia; Godelieve J De Bree; Dorte Hamann; Rene A W Van Lier; Marinus H J Van OersBlood2003Expansion of CMV-specific CD8+CD45RA+CD27- T cells in B-cell chronic lymphocytic leukemia.
12662440Aaron E Foster; David J Gottlieb; Marina Marangolo; Anna Bartlett; Yi-Chiao Li; Geoffrey W Barton; Jose A Romagnoli; Kenneth F BradstockJ Hematother Stem Cell Res2003Rapid, large-scale generation of highly pure cytomegalovirus-specific cytotoxic T cells for adoptive immunotherapy.
12653848P Höllsberg; H J Hansen; S HaahrClin Exp Immunol2003Altered CD8+ T cell responses to selected Epstein-Barr virus immunodominant epitopes in patients with multiple sclerosis.
12634406Ghislaine Gallez-Hawkins; Maria C Villacres; Xiuli Li; Margaret C Sanborn; Norma A Lomeli; John A ZaiaJ Virol2003Use of transgenic HLA A*0201/Kb and HHD II mice to evaluate frequency of cytomegalovirus IE1-derived peptide usage in eliciting human CD8 cytokine response.
12616496Yamina Hamel; Pierre Rohrlich; Véronique Baron; Delphine Bonhomme; Frederic Rieux-Laucat; Antje Necker; François Lemonnier; Laurent Ferradini; Alain Fischer; Marina Cavazzana-CalvoEur J Immunol2003Characterization of antigen-specific repertoire diversity following in vitro restimulation by a recombinant adenovirus expressing human cytomegalovirus pp65.
12393402Evren Ozdemir; Lisa S St John; Geraldine Gillespie; Sarah Rowland-Jones; Richard E Champlin; Jeffrey J Molldrem; Krishna V KomanduriBlood2002Cytomegalovirus reactivation following allogeneic stem cell transplantation is associated with the presence of dysfunctional antigen-specific CD8+ T cells.
12374455Aaron E Foster; David J Gottlieb; Mary Sartor; Mark S Hertzberg; Kenneth F BradstockBiol Blood Marrow Transplant2002Cytomegalovirus-specific CD4+ and CD8+ T-cells follow a similar reconstitution pattern after allogeneic stem cell transplantation.
12169019K S Lang; A Moris; C Gouttefangeas; S Walter; V Teichgräber; M Miller; D Wernet; K Hamprecht; H G Rammensee; S StevanovicCell Mol Life Sci2002High frequency of human cytomegalovirus (HCMV)-specific CD8+ T cells detected in a healthy CMV-seropositive donor.
12165524Naeem Khan; Naseer Shariff; Mark Cobbold; Rachel Bruton; Jenni A Ainsworth; Alan J Sinclair; Laxman Nayak; Paul A H MossJ Immunol2002Cytomegalovirus seropositivity drives the CD8 T cell repertoire toward greater clonality in healthy elderly individuals.
12142557Maurizio Provenzano; Simone Mocellin; Maria Bettinotti; Jeanne Preuss; Vladia Monsurrò; Francesco M Marincola; David StroncekJ Immunother2002Identification of immune dominant cytomegalovirus epitopes using quantitative real-time polymerase chain reactions to measure interferon-gamma production by peptide-stimulated peripheral blood mononuclear cells.
11953041H Einsele; G Rauser; U Grigoleit; H Hebart; C Sinzger; S Riegler; G JahnCytotherapy2002Induction of CMV-specific T-cell lines using Ag-presenting cells pulsed with CMV protein or peptide.
11930311Naeem Khan; Mark Cobbold; Russell Keenan; Paul A H MossJ Infect Dis2002Comparative analysis of CD8+ T cell responses against human cytomegalovirus proteins pp65 and immediate early 1 shows similarities in precursor frequency, oligoclonality, and phenotype.
17442927Eleni Adamopoulou; Jan Diekmann; Eva Tolosa; Gaby Kuntz; Hermann Einsele; Hans-Georg Rammensee; Max S ToppJ Immunol2007Human CD4+ T cells displaying viral epitopes elicit a functional virus-specific memory CD8+ T cell response.
17462006S Walker; C Fazou; T Crough; R Holdsworth; P Kiely; M Veale; S Bell; A Gailbraith; K McNeil; S Jones; R KhannaTranspl Infect Dis2007Ex vivo monitoring of human cytomegalovirus-specific CD8+ T-cell responses using QuantiFERON-CMV.
17412970Katrin Besold; Nadine Frankenberg; Sandra Pepperl-Klindworth; Jürgen Kuball; Matthias Theobald; Gabriele Hahn; Bodo PlachterJ Gen Virol2007Processing and MHC class I presentation of human cytomegalovirus pp65-derived peptides persist despite gpUS2-11-mediated immune evasion.
9701254F Kern; I P Surel; C Brock; B Freistedt; H Radtke; A Scheffold; R Blasczyk; P Reinke; J Schneider-Mergener; A Radbruch; P Walden; H D VolkNat Med1998T-cell epitope mapping by flow cytometry.
10980387L BenMohamed; R Krishnan; J Longmate; C Auge; L Low; J Primus; D J DiamondHum Immunol2000Induction of CTL response by a minimal epitope vaccine in HLA A*0201/DR1 transgenic mice: dependence on HLA class II restricted T(H) response.
15619009M-D Nastke; L Herrgen; S Walter; D Wernet; H-G Rammensee; S StevanovićCell Mol Life Sci2005Major contribution of codominant CD8 and CD4 T cell epitopes to the human cytomegalovirus-specific T cell repertoire.
12651070Simon F Lacey; Maria C Villacres; Corinna La Rosa; Zhongde Wang; Jeff Longmate; Joybelle Martinez; John C Brewer; Shahram Mekhoubad; Rebecca Maas; John M Leedom; Stephen J Forman; John A Zaia; Don J DiamondHum Immunol2003Relative dominance of HLA-B*07 restricted CD8+ T-lymphocyte immune responses to human cytomegalovirus pp65 in persons sharing HLA-A*02 and HLA-B*07 alleles.
17492595Laura Gibson; Sheryl Dooley; Sonia Trzmielina; Mohan Somasundaran; Donna Fisher; Maria Grazia Revello; Katherine LuzuriagaJ Infect Dis2007Cytomegalovirus (CMV) IE1- and pp65-specific CD8+ T cell responses broaden over time after primary CMV infection in infants.
15288697Rosanna Vescovini; Annarita Telera; Francesco F Fagnoni; Claudia Biasini; Maria Cristina Medici; Pierpaolo Valcavi; Patricia di Pede; Gianluca Lucchini; Luca Zanlari; Giovanni Passeri; Franco Zanni; Carlo Chezzi; Claudio Franceschi; Paolo SansoniExp Gerontol2004Different contribution of EBV and CMV infections in very long-term carriers to age-related alterations of CD8+ T cells.
15172452Pierre S Rohrlich; Sylvain Cardinaud; Jacqueline Lulè; Felix A Montero-Julian; Virginie Prodhomme; Hüseyin Firat; Jean-Luc Davignon; Emmanuelle Perret; Sylvain Monseaux; Antje Necker; Susan Michelson; François A Lemonnier; Pierre Charneau; Christian DavrincheHum Immunol2004Use of a lentiviral vector encoding a HCMV-chimeric IE1-pp65 protein for epitope identification in HLA-Transgenic mice and for ex vivo stimulation and expansion of CD8(+) cytotoxic T cells from human peripheral blood cells.
12028562G Gallez-Hawkins; N A Lomeli; X L Li; Z Q Yao; C La Rosa; D J Diamond; J A ZaiaScand J Immunol2002Kinase-deficient CMVpp65 triggers a CMVpp65 specific T-cell immune response in HLA-A*0201.Kb transgenic mice after DNA immunization.
16388983Zhongde Wang; Corinna La Rosa; Simon F Lacey; Rebecca Maas; Shahram Mekhoubad; William J Britt; Don J DiamondJ Clin Virol2006Attenuated poxvirus expressing three immunodominant CMV antigens as a vaccine strategy for CMV infection.
17686555Verena Schlaphoff; Christoph S Klade; Bernd Jilma; Sandra B Jelovcan; Markus Cornberg; Erich Tauber; Michael P Manns; Heiner Wedemeyer; IC41 Study GroupVaccine2007Functional and phenotypic characterization of peptide-vaccine-induced HCV-specific CD8+ T cells in healthy individuals and chronic hepatitis C patients.
17611062Giuseppina Colonna-Romano; Arne N Akbar; Alessandra Aquino; Matteo Bulati; Giuseppina Candore; Domenico Lio; Pietro Ammatuna; Jean M Fletcher; Calogero Caruso; Graham PawelecExp Gerontol2007Impact of CMV and EBV seropositivity on CD8 T lymphocytes in an old population from West-Sicily.
17686874Tania Crough; Chrysa Fazou; Julissa Weiss; Scott Campbell; Miles P Davenport; Scott C Bell; Andrew Galbraith; Keith McNeil; Rajiv KhannaJ Virol2007Symptomatic and asymptomatic viral recrudescence in solid-organ transplant recipients and its relationship with the antigen-specific CD8(+) T-cell response.
14764694Laura Gibson; Giampiero Piccinini; Daniele Lilleri; Maria Grazia Revello; Zhongde Wang; Susan Markel; Don J Diamond; Katherine LuzuriagaJ Immunol2004Human cytomegalovirus proteins pp65 and immediate early protein 1 are common targets for CD8+ T cell responses in children with congenital or postnatal human cytomegalovirus infection.
17065344Qin Ouyang; Nathan E Standifer; Huilian Qin; Peter Gottlieb; C Bruce Verchere; Gerald T Nepom; Rusung Tan; Constadina PanagiotopoulosDiabetes2006Recognition of HLA class I-restricted beta-cell epitopes in type 1 diabetes.
17878400Edward C P Waller; Nicola McKinney; Ray Hicks; Andrew J Carmichael; J G Patrick Sissons; Mark R WillsBlood2007Differential costimulation through CD137 (4-1BB) restores proliferation of human virus-specific "effector memory" (CD28(-) CD45RA(HI)) CD8(+) T cells.
18246203Victoria Kasprowicz; Scott M Ward; Alison Turner; Alexandros Grammatikos; Brian E Nolan; Lia Lewis-Ximenez; Charles Sharp; Jenny Woodruff; Vicki M Fleming; Stuart Sims; Bruce D Walker; Andrew K Sewell; Georg M Lauer; Paul KlenermanJ Clin Invest2008Defining the directionality and quality of influenza virus-specific CD8+ T cell cross-reactivity in individuals infected with hepatitis C virus.
18261836Erica Dander; Giuseppina Li Pira; Ettore Biagi; Paolo Perseghin; Giuliano Renoldi; Giuseppe Gaipa; Martino Introna; Virna Marin; Fabrizio Manca; Andrea Biondi; Giovanna D'AmicoExp Hematol2008Characterization of migratory activity and cytokine profile of helper and cytotoxic CMV-specific T-cell lines expanded by a selective peptide library.
17929331Matthew A Jones; Jatinder K Notta; Mark Cobbold; Mainthan Palendira; Andrew D Hislop; John Wilkie; John S SnaithJ Pept Sci2008Synthesis and ex vivo profiling of chemically modified cytomegalovirus CMVpp65 epitopes.
18366814Holden T Maecker; Jeffrey Hassler; Janice K Payne; Amanda Summers; Karrie Comatas; Manar Ghanayem; Michael A Morse; Timothy M Clay; Herbert K Lyerly; Sonny Bhatia; Smita A Ghanekar; Vernon C Maino; Corazon Delarosa; Mary L DisisBMC Immunol2008Precision and linearity targets for validation of an IFNgamma ELISPOT, cytokine flow cytometry, and tetramer assay using CMV peptides.
18582401Guang Ping Ruan; Li Ma; Qian Wen; Wei Luo; Ming Qian Zhou; Xiao Ning WangCell Mol Immunol2008A modified peptide stimulation method for efficient amplification of cytomegalovirus (CMV)-specific CTLs.
18538862Cristina Ulivieri; Alessandra Citro; Federico Ivaldi; Dina Mascolo; Raffaella Ghittoni; Daniela Fanigliulo; Fabrizio Manca; Cosima Tatiana Baldari; Giuseppina Li Pira; Giovanna Del PozzoImmunol Lett2008Antigenic properties of HCMV peptides displayed by filamentous bacteriophages vs. synthetic peptides.
18538366Z Wang; W Zhou; T Srivastava; C La Rosa; A Mandarino; S J Forman; J A Zaia; W J Britt; D J DiamondVirology2008A fusion protein of HCMV IE1 exon4 and IE2 exon5 stimulates potent cellular immunity in an MVA vaccine vector.
18418774Ac Hobeika; T Osada; D Serra; S Peplinski; K Hanson; Y Tanaka; D Niedzwiecki; N Chao; D Rizzieri; Hk Lyerly; T Clay; Ma MorseCytotherapy2008Detailed analysis of cytomegalovirus (CMV)-specific T cells expanded for adoptive immunotherapy of CMV infection following allogeneic stem cell transplantation for malignant disease.
17698636Markus M Weck; Silke Appel; Daniela Werth; Christian Sinzger; Anita Bringmann; Frank Grünebach; Peter BrossartBlood2008hDectin-1 is involved in uptake and cross-presentation of cellular antigens.
18760281Thomas C Wehler; Michael Karg; Eva Distler; Abdo Konur; Marion Nonn; Ralf G Meyer; Christoph Huber; Udo F Hartwig; Wolfgang HerrJ Immunol Methods2008Rapid identification and sorting of viable virus-reactive CD4(+) and CD8(+) T cells based on antigen-triggered CD137 expression.
18677654Kazue Watanabe; Susumu Suzuki; Michi Kamei; Shingo Toji; Takakazu Kawase; Toshitada Takahashi; Kiyotaka Kuzushima; Yoshiki AkatsukaInt J Hematol2008CD137-guided isolation and expansion of antigen-specific CD8 cells for potential use in adoptive immunotherapy.
18639344Daisuke Hayashi; Ryuji Kubota; Norihiro Takenouchi; Yuetsu Tanaka; Ryuki Hirano; Hiroshi Takashima; Mitsuhiro Osame; Shuji Izumo; Kimiyoshi ArimuraJ Neuroimmunol2008Reduced Foxp3 expression with increased cytomegalovirus-specific CTL in HTLV-I-associated myelopathy.
18566421Matthew R Pipeling; Erin E West; Christine M Osborne; Amanda B Whitlock; Lesia K Dropulic; Matthew H Willett; Michael Forman; Alexandra Valsamakis; Jonathan B Orens; David R Moller; Noah Lechtzin; Stephen A Migueles; Mark Connors; John F McDyerJ Immunol2008Differential CMV-specific CD8+ effector T cell responses in the lung allograft predominate over the blood during human primary infection.
18539483Thi H O Nguyen; Nicole A Mifsud; Lisbeth A Stewart; Mingus J Rose; Tamara L Etto; Nicholas A Williamson; Anthony W Purcell; Tom Kotsimbos; Anthony P SchwarerProtein Expr Purif2008Refinement in the production and purification of recombinant HCMV IE1-pp65 protein for the generation of epitope-specific T cell immunity.
18768532Marieke Griffioen; H M Esther van Egmond; Helen Barnby-Porritt; Menno A W G van der Hoorn; Renate S Hagedoorn; Michel G D Kester; Nikolai Schwabe; Roel Willemze; J H Frederik Falkenburg; Mirjam H M HeemskerkHaematologica2008Genetic engineering of virus-specific T cells with T-cell receptors recognizing minor histocompatibility antigens for clinical application.
18953722Juliane Schalich; Oresta Vytvytska; Wolfgang Zauner; Michael B Fischer; Michael Buschle; Gerald Aichinger; Christoph S KladeBiol Chem2008Analysis of the human cytomegalovirus pp65-directed T-cell response in healthy HLA-A2-positive individuals.
16197958Susan J Gagnon; Oleg Y Borbulevych; Rebecca L Davis-Harrison; Tiffany K Baxter; John R Clemens; Kathryn M Armstrong; Richard V Turner; Marale Damirjian; William E Biddison; Brian M BakerJ Mol Biol2005Unraveling a hotspot for TCR recognition on HLA-A2: evidence against the existence of peptide-independent TCR binding determinants.
18806877Jie Zhong; Michael Rist; Leanne Cooper; Corey Smith; Rajiv KhannaPLoS One2008Induction of pluripotent protective immunity following immunisation with a chimeric vaccine against human cytomegalovirus.
19017975Vanessa Venturi; Hui Yee Chin; Tedi E Asher; Kristin Ladell; Phillip Scheinberg; Ethan Bornstein; David van Bockel; Anthony D Kelleher; Daniel C Douek; David A Price; Miles P DavenportJ Immunol2008TCR beta-chain sharing in human CD8+ T cell responses to cytomegalovirus and EBV.
18982061Thomas Widmann; Urban Sester; Barbara C Gärtner; Jörg Schubert; Michael Pfreundschuh; Hans Köhler; Martina SesterPLoS One2008Levels of CMV specific CD4 T cells are dynamic and correlate with CMV viremia after allogeneic stem cell transplantation.
18848854Haiyan Qin; George Vlad; Raffaello Cortesini; Nicole Suciu-Foca; John S ManavalanHum Immunol2008CD8+ suppressor and cytotoxic T cells recognize the same human leukocyte antigen-A2 restricted cytomegalovirus peptide.
18799721Nina Babel; Gordon Brestrich; Lukasz P Gondek; Arne Sattler; Marcin W Wlodarski; Nina Poliak; Nicole Bethke; Andreas Thiel; Markus H Hammer; Petra Reinke; Jaroslaw P MaciejewskiJ Am Soc Nephrol2009Clonotype analysis of cytomegalovirus-specific cytotoxic T lymphocytes.
18792106Rik A Brooimans; Christopher S Boyce; Janice Popma; Dennis A Broyles; Jan W Gratama; Paula C Southwick; Michael KeeneyCytometry A2008Analytical performance of a standardized single-platform MHC tetramer assay for the identification and enumeration of CMV-specific CD8+ T lymphocytes.
19014475Angelika Schwanninger; Birgit Weinberger; Daniela Weiskopf; Dietmar Herndler-Brandstetter; Stephan Reitinger; Christoph Gassner; Harald Schennach; Walther Parson; Reinhard Würzner; Beatrix Grubeck-LoebensteinImmun Ageing2008Age-related appearance of a CMV-specific high-avidity CD8+ T cell clonotype which does not occur in young adults.
18706443Aparna Krishnan; Zhongde Wang; Tumul Srivastava; Ravindra Rawal; Pooja Manchanda; Don J Diamond; Corinna La RosaImmunol Lett2008A novel approach to evaluate the immunogenicity of viral antigens of clinical importance in HLA transgenic murine models.
19248785Anita Schmitt; Clemens Bechter; Junxia Yao; Marlies Goetz; Birgit Maccari; Peter Schauwecker; Markus Wiesneth; Michael SchmittJ Immunol Methods2009Cytomegalovirus vaccination of leukemia and lymphoma patients after allogeneic stem cell transplantation--validation of a peptide vaccine.
18657205Chris C Ibegbu; Yong-Xian Xu; Dimitri Fillos; Henry Radziewicz; Arash Grakoui; Athena P KourtisImmunology2009Differential expression of CD26 on virus-specific CD8(+) T cells during active, latent and resolved infection.
18945878Giuseppina Li Pira; Federico Ivaldi; Chiara Dentone; Elda Righi; Valerio Del Bono; Claudio Viscoli; Gerrit Koopman; Fabrizio MancaClin Vaccine Immunol2008Evaluation of antigen-specific T-cell responses with a miniaturized and automated method.
19403059Wei Luo; Li Ma; Qian Wen; Mingqian Zhou; Xiaoning WangCell Mol Immunol2009Analysis of the conservation of T cell receptor alpha and beta chain variable regions gene in pp65 peptide-specific HLA-A*0201-restricted CD8+ T cells.
19443656Patrick J Hanley; Conrad Russell Young Cruz; Barbara Savoldo; Ann M Leen; Maja Stanojevic; Mariam Khalil; William Decker; Jeffrey J Molldrem; Hao Liu; Adrian P Gee; Cliona M Rooney; Helen E Heslop; Gianpietro Dotti; Malcolm K Brenner; Elizabeth J Shpall; Catherine M BollardBlood2009Functionally active virus-specific T cells that target CMV, adenovirus, and EBV can be expanded from naive T-cell populations in cord blood and will target a range of viral epitopes.
19635907Aisha N Hasan; Wouter J Kollen; Deepa Trivedi; Annamalai Selvakumar; Bo Dupont; Michel Sadelain; Richard J O'ReillyJ Immunol2009A panel of artificial APCs expressing prevalent HLA alleles permits generation of cytotoxic T cells specific for both dominant and subdominant viral epitopes for adoptive therapy.
19542454Stéphanie Gras; Xavier Saulquin; Jean-Baptiste Reiser; Emilie Debeaupuis; Klara Echasserieau; Adrien Kissenpfennig; François Legoux; Anne Chouquet; Madalen Le Gorrec; Paul Machillot; Bérangère Neveu; Nicole Thielens; Bernard Malissen; Marc Bonneville; Dominique HoussetJ Immunol2009Structural bases for the affinity-driven selection of a public TCR against a dominant human cytomegalovirus epitope.
19542443Emanuela M Iancu; Patricia Corthesy; Petra Baumgaertner; Estelle Devevre; Verena Voelter; Pedro Romero; Daniel E Speiser; Nathalie RuferJ Immunol2009Clonotype selection and composition of human CD8 T cells specific for persistent herpes viruses varies with differentiation but is stable over time.
19605492Delphine Sauce; Martin Larsen; Rachel J M Abbott; Andrew D Hislop; Alison M Leese; Naeem Khan; Laura Papagno; Gordon J Freeman; Alan B RickinsonJ Virol2009Upregulation of interleukin 7 receptor alpha and programmed death 1 marks an epitope-specific CD8+ T-cell response that disappears following primary Epstein-Barr virus infection.
19801502Daniela Weiskopf; Angelika Schwanninger; Birgit Weinberger; Giovanni Almanzar; Walther Parson; Soren Buus; Herbert Lindner; Beatrix Grubeck-LoebensteinJ Leukoc Biol2010Oxidative stress can alter the antigenicity of immunodominant peptides.
19715728Birgit Weinberger; Kathrin Welzl; Dietmar Herndler-Brandstetter; Walther Parson; Beatrix Grubeck-LoebensteinImmunol Lett2009CD28(-)CD8(+) T cells do not contain unique clonotypes and are therefore dispensable.
19908941W Zhang; R Caspell; A Y Karulin; M Ahmad; N Haicheur; A Abdelsalam; K Johannesen; V Vignard; P Dudzik; K Georgakopoulou; A Mihaylova; K Silina; N Aptsiauri; V Adams; P V Lehmann; S McArdleJ Immunotoxicol2009ELISPOT assays provide reproducible results among different laboratories for T-cell immune monitoring--even in hands of ELISPOT-inexperienced investigators.
19923740Jean Baptiste Reiser; François Legoux; Paul Machillot; Emilie Debeaupuis; Béatrice Le Moullac-Vaydie; Anne Chouquet; Xavier Saulquin; Marc Bonneville; Dominique HoussetActa Crystallogr Sect F Struct Biol Cryst Commun2009Crystallization and preliminary X-ray crystallographic characterization of a public CMV-specific TCR in complex with its cognate antigen.
19952955Ananta Paine; Mathias Oelke; Sabine Tischer; Hans-Gert Heuft; Rainer Blasczyk; Britta Eiz-VesperJ Immunother2010Soluble recombinant CMVpp65 spanning multiple HLA alleles for reconstitution of antiviral CD4+ and CD8+ T-cell responses after allogeneic stem cell transplantation.
20095088Sandra Giest; Sarah Grace; Alexandra C Senegaglia; Ricardo Pasquini; Rosa M Gonzalo-Daganzo; Manuel N Fernández; Stephen Mackinnon; J Alejandro Madrigal; Paul J TraversBr J Haematol2010Cytomegalovirus-specific CD8(+) T cells targeting different HLA/peptide combinations correlate with protection but at different threshold frequencies.
19950243Jakub Kopycinski; Mohamed Osman; Paul D Griffiths; Vincent C EmeryJ Med Virol2010Sequence flexibility of the immunodominant HLA A*0201 restricted ppUL83 CD8 T-cell epitope of human cytomegalovirus.
19813020Henry Ogbomo; Janina Geiler; Anke Leutz; Kristina von Kietzell; Martin Michaelis; Hans Wilhelm Doerr; Jindrich Cinatl JrMed Microbiol Immunol2009Measurement of cytotoxic T lymphocyte activity of human cytomegalovirus seropositive individuals by a highly sensitive coupled luminescent method.
Mikkel Harndahl; Kasper Lamberth Ph.D.; Gustav Roder; Sune Justesen; Michael Madsen; Morten Nielsen; Claus Lundegaard; Mette Voldby Larsen; Sheila Tang; Soren Brunak; Ole Lund; Soren Buus2010Large scale analysis of peptide-HLA class I interactions
20306470Oryan Makler; Kfir Oved; Nir Netzer; Dana Wolf; Yoram ReiterEur J Immunol2010Direct visualization of the dynamics of antigen presentation in human cells infected with cytomegalovirus revealed by antibodies mimicking TCR specificity.
20483723François Legoux; Emilie Debeaupuis; Klara Echasserieau; Henri De La Salle; Xavier Saulquin; Marc BonnevilleJ Immunol2010Impact of TCR reactivity and HLA phenotype on naive CD8 T cell frequency in humans.
14670917Georg Rauser; Hermann Einsele; Christian Sinzger; Dorothee Wernet; Gabriele Kuntz; Mario Assenmacher; John D M Campbell; Max S ToppBlood2004Rapid generation of combined CMV-specific CD4+ and CD8+ T-cell lines for adoptive transfer into recipients of allogeneic stem cell transplants.
16237088Arend Mulder; Chantal Eijsink; Michel G D Kester; Marry E I Franke; Marrie J Kardol; Mirjam H M Heemskerk; Cees van Kooten; Frank A Verreck; Jan Wouter Drijfhout; Frits Koning; Ilias I N Doxiadis; Frans H J ClaasJ Immunol2005Impact of peptides on the recognition of HLA class I molecules by human HLA antibodies.
20655401Sabine Becke; Steffi Aue; Doris Thomas; Sina Schader; Jürgen Podlech; Tobias Bopp; Tina Sedmak; Uwe Wolfrum; Bodo Plachter; Sabine ReydaVaccine2010Optimized recombinant dense bodies of human cytomegalovirus efficiently prime virus specific lymphocytes and neutralizing antibodies without the addition of adjuvant.
20195281Thi H O Nguyen; Lucy C Sullivan; Tom C Kotsimbos; Anthony P Schwarer; Nicole A MifsudImmunol Cell Biol2010Cross-presentation of HCMV chimeric protein enables generation and measurement of polyclonal T cells.
20711433Alexis Morice; Béatrice Charreau; Bérangère Neveu; Sophie Brouard; Jean-Paul Soulillou; Marc Bonneville; Elisabeth Houssaint; Nicolas DegauquePLoS One2010Cross-reactivity of herpesvirus-specific CD8 T cell lines toward allogeneic class I MHC molecules.
20558172Jonas Stanke; Corinna Hoffmann; Ulrike Erben; Helmut von Keyserling; Stefan Stevanovic; Guenter Cichon; Achim Schneider; Andreas M KaufmannJ Immunol Methods2010A flow cytometry-based assay to assess minute frequencies of CD8+ T cells by their cytolytic function.
20722762Naeem Khan; Mark Cobbold; Joanne Cummerson; Paul A H MossImmunology2010Persistent viral infection in humans can drive high frequency low-affinity T-cell expansions.
20738423Diana L Wallace; Joanne E Masters; Catherine M De Lara; Sian M Henson; Andrew Worth; Yan Zhang; Shikha R Kumar; Peter C Beverley; Arne N Akbar; Derek C MacallanImmunology2011Human cytomegalovirus-specific CD8(+) T-cell expansions contain long-lived cells that retain functional capacity in both young and elderly subjects.
21536322Sayed Mahdi Marashi; Mohammad Raeiszadeh; Sarita Workman; Afsar Rahbar; Cecilia Soderberg-Naucler; Paul Klenerman; Ronnie Chee; A David Webster; Richard S B Milne; Vincent C EmeryJ Allergy Clin Immunol2011Inflammation in common variable immunodeficiency is associated with a distinct CD8(+) response to cytomegalovirus.
21585633S Borchers; S Luther; U Lips; N Hahn; J Kontsendorn; M Stadler; S Buchholz; H Diedrich; M Eder; U Koehl; A Ganser; E Mischak-WeissingerTranspl Infect Dis2011Tetramer monitoring to assess risk factors for recurrent cytomegalovirus reactivation and reconstitution of antiviral immunity post allogeneic hematopoietic stem cell transplantation.
21389867Maarten L Zandvliet; Ellis van Liempt; Inge Jedema; Simone Kruithof; Michel G D Kester; Henk-Jan Guchelaar; J H Frederik Falkenburg; Pauline MeijJ Immunother2011Simultaneous isolation of CD8(+) and CD4(+) T cells specific for multiple viruses for broad antiviral immune reconstitution after allogeneic stem cell transplantation.
21668362Rebecca C Robey; Salvinia Mletzko; Mark Bower; Rhonda Meys; Marta Boffito; Mark Nelson; Christopher B Bunker; Frances M GotchViral Immunol2011Ex-vivo recognition of late-lytic CD8 epitopes specific for Kaposi's sarcoma-associated herpesvirus (KSHV) by HIV/KSHV-coinfected individuals.
19655750Patrick H N Celie; Mireille Toebes; Boris Rodenko; Huib Ovaa; Anastassis Perrakis; Ton N M SchumacherJ Am Chem Soc2009UV-induced ligand exchange in MHC class I protein crystals.
21860612Jung-Sun Park; Soo-Young Park; Hyun-Il Cho; Hyun-Jung Sohn; Tai-Gyu KimImmune Netw2011Enhanced Induction of T Cell Immunity Using Dendritic Cells Pulsed with HIV Tat and HCMV-pp65 Fusion Protein In Vitro.
21810614Michael Reiser; Andreas Wieland; Bodo Plachter; Thomas Mertens; Jochen Greiner; Reinhold SchirmbeckJ Immunol2011The immunodominant CD8 T cell response to the human cytomegalovirus tegument phosphoprotein pp65(495-503) epitope critically depends on CD4 T cell help in vaccinated HLA-A*0201 transgenic mice.
21911137S Lee; J B Park; E Y Kim; S Y Joo; E C Shin; C H Kwon; J W Joh; S J KimTransplant Proc2011Monitoring of cytomegalovirus-specific CD8+ T-cell response with major histocompatibility complex pentamers in kidney transplant recipients.
21850230Pleun Hombrink; Sine R Hadrup; Arne Bakker; Michel G D Kester; J H Frederik Falkenburg; Peter A von dem Borne; Ton N M Schumacher; Mirjam H M HeemskerkPLoS One2011High-throughput identification of potential minor histocompatibility antigens by MHC tetramer-based screening: feasibility and limitations.
21274637Sean X Leng; Tao Qu; Richard D Semba; Huifen Li; Xu Yao; Tricia Nilles; Xi Yang; Bhavish Manwani; Jeremy D Walston; Luigi Ferrucci; Linda P Fried; Joseph B Margolick; Jay H BreamAge (Dordr)2011Relationship between cytomegalovirus (CMV) IgG serology, detectable CMV DNA in peripheral monocytes, and CMV pp65(495-503)-specific CD8+ T cells in older adults.
21998398Sandrine Luce; François Lemonnier; Jean-Paul Briand; Joel Coste; Najiba Lahlou; Sylviane Muller; Etienne Larger; Benedita Rocha; Roberto Mallone; Christian BoitardDiabetes2011Single insulin-specific CD8+ T cells show characteristic gene expression profiles in human type 1 diabetes.
21992180Sabine Tischer; Megan Basila; Britta Maecker-Kolhoff; Stephan Immenschuh; Mathias Oelke; Rainer Blasczyk; Britta Eiz-VesperJ Transl Med2011Heat shock protein 70/peptide complexes: potent mediators for the generation of antiviral T cells particularly with regard to low precursor frequencies.
21883919C Aspord; D Laurin; M-J Richard; H Vie; L Chaperot; J PlumasAm J Transplant2011Induction of antiviral cytotoxic T cells by plasmacytoid dendritic cells for adoptive immunotherapy of posttransplant diseases.
22130159Gertjan Lugthart; Sarah J Albon; Ida Ricciardelli; Michel G D Kester; Pauline Meij; Arjan C Lankester; Persis J AmroliaJ Immunother2012Simultaneous generation of multivirus-specific and regulatory T cells for adoptive immunotherapy.
22044339Sandra Giest; Alasdair McWhinnie; Marie-Paule Lefranc; Ann-Margaret Little; Sarah Grace; Stephen Mackinnon; J Alejandro Madrigal; Paul J TraversImmunology2012Cytomegalovirus-specific CD8+ T cells targeting different peptide/HLA combinations demonstrate varying T-cell receptor diversity.
22197248Ping Zhao; Dao-Xin Ma; Shuang Yu; Fu-Zhong Xue; Wei-Wei Zhu; Na Shao; Jing-Ru Zhang; Chun-Yan JiAntiviral Res2012The development of Chinese specific human cytomegalovirus polyepitope recombinant vaccine.
21441962J Jelinek; I Adkins; Z Mikulkova; J Jagosova; R Pacasova; S Michlickova; P Sebo; J MichalekBone Marrow Transplant2012In vitro activation of CMV-specific human CD8(+) T cells by adenylate cyclase toxoids delivering pp65 epitopes.
22306902Maarten L Zandvliet; Michel G D Kester; Ellis van Liempt; Arnoud H de Ru; Peter A van Veelen; Marieke Griffioen; Henk-Jan Guchelaar; J H Frederik Falkenburg; Pauline MeijJ Immunother2012Efficiency and mechanism of antigen-specific CD8+ T-cell activation using synthetic long peptides.
12475762K S Lang; C Weigert; S Braedel; S Fillon; M Palmada; E Schleicher; H-G Rammensee; F LangAm J Physiol Cell Physiol2003Inhibition of interferon-gamma expression by osmotic shrinkage of peripheral blood lymphocytes.
22402037Corinna La Rosa; Jeff Longmate; Simon F Lacey; Teodora Kaltcheva; Rahul Sharan; Denise Marsano; Peter Kwon; Jennifer Drake; Brenda Williams; Sharon Denison; Suenell Broyer; Larry Couture; Ryotaro Nakamura; Sanjeet Dadwal; Morris I Kelsey; Arthur M Krieg; Don J Diamond; John A ZaiaJ Infect Dis2012Clinical evaluation of safety and immunogenicity of PADRE-cytomegalovirus (CMV) and tetanus-CMV fusion peptide vaccines with or without PF03512676 adjuvant.
22461701Samantha Jilek; Myriam Schluep; Alexandre Harari; Mathieu Canales; Andreas Lysandropoulos; Anastasia Zekeridou; Giuseppe Pantaleo; Renaud A Du PasquierJ Immunol2012HLA-B7-restricted EBV-specific CD8+ T cells are dysregulated in multiple sclerosis.
22444511Sayed Mahdi Marashi; Mohammed Raeiszadeh; Victoria Enright; Fariba Tahami; Sarita Workman; Ronnie Chee; A David Webster; Richard S B Milne; Vincent C EmeryJ Allergy Clin Immunol2012Influence of cytomegalovirus infection on immune cell phenotypes in patients with common variable immunodeficiency.
19655751Boris Rodenko; Mireille Toebes; Patrick H N Celie; Anastassis Perrakis; Ton N M Schumacher; Huib OvaaJ Am Chem Soc2009Class I major histocompatibility complexes loaded by a periodate trigger.
22706083Sabrina Urban; Kathrin Textoris-Taube; Barbara Reimann; Katharina Janek; Tanja Dannenberg; Frédéric Ebstein; Christin Seifert; Fang Zhao; Jan H Kessler; Anne Halenius; Petra Henklein; Julia Paschke; Sandrine Cadel; Helga Bernhard; Ferry Ossendorp; Thierry Foulon; Dirk Schadendorf; Annette Paschen; Ulrike SeifertJ Immunol2012The efficiency of human cytomegalovirus pp65(495-503) CD8+ T cell epitope generation is determined by the balanced activities of cytosolic and endoplasmic reticulum-resident peptidases.
22691433Anusara Daenthanasanmak; Gustavo Salguero; Sylvia Borchers; Constanca Figueiredo; Roland Jacobs; Bala Sai Sundarasetty; Andreas Schneider; Axel Schambach; Britta Eiz-Vesper; Rainer Blasczyk; Eva M Weissinger; Arnold Ganser; Renata StripeckeVaccine2012Integrase-defective lentiviral vectors encoding cytokines induce differentiation of human dendritic cells and stimulate multivalent immune responses in vitro and in vivo.
22801446Ulrike Gerdemann; Jacqueline M Keirnan; Usha L Katari; Ryu Yanagisawa; Anne S Christin; Leslie E Huye; Serena K Perna; Sravya Ennamuri; Stephen Gottschalk; Malcolm K Brenner; Helen E Heslop; Cliona M Rooney; Ann M LeenMol Ther2012Rapidly generated multivirus-specific cytotoxic T lymphocytes for the prophylaxis and treatment of viral infections.
22740564Sabine Tischer; Till Kaireit; Constança Figueiredo; Oliver Hiller; Britta Maecker-Kolhoff; Renè Geyeregger; Stephan Immenschuh; Rainer Blasczyk; Britta Eiz-VesperInt Immunol2012Establishment of the reversible peptide-major histocompatibility complex (pMHC) class I Histamer technology: tool for visualization and selection of functionally active antigen-specific CD8(+) T lymphocytes.
22996368Pauline Meij; Inge Jedema; Maarten L Zandvliet; Pim L J van der Heiden; Marian van de Meent; H M Esther van Egmond; Ellis van Liempt; Conny Hoogstraten; Simone Kruithof; Sabrina Veld; Erik W A Marijt; Peter A von dem Borne; Arjan C Lankester; Constantijn J M Halkes; J H Frederik FalkenburgJ Immunother2012Effective treatment of refractory CMV reactivation after allogeneic stem cell transplantation with in vitro-generated CMV pp65-specific CD8+ T-cell lines.
22735080Susumu Suzuki; Ayako Masaki; Takashi Ishida; Asahi Ito; Fumiko Mori; Fumihiko Sato; Tomoko Narita; Masaki Ri; Shigeru Kusumoto; Hirokazu Komatsu; Yasuo Fukumori; Hiroyoshi Nishikawa; Yuetsu Tanaka; Akio Niimi; Hiroshi Inagaki; Shinsuke Iida; Ryuzo UedaCancer Sci2012Tax is a potential molecular target for immunotherapy of adult T-cell leukemia/lymphoma.
22965172Nadine Frankenberg; Peter Lischka; Sandra Pepperl-Klindworth; Thomas Stamminger; Bodo PlachterMed Microbiol Immunol2012Nucleocytoplasmic shuttling and CRM1-dependent MHC class I peptide presentation of human cytomegalovirus pp65.
23202497Wenji Zhang; Ioana Moldovan; Oleg S Targoni; Ramu A Subbramanian; Paul V LehmannViruses2012How much of virus-specific CD8 T cell reactivity is detected with a peptide pool when compared to individual peptides?
22936177Robin R Knight; Deborah Kronenberg; Min Zhao; Guo Cai Huang; Martin Eichmann; Anna Bulek; Linda Wooldridge; David K Cole; Andrew K Sewell; Mark Peakman; Ania SkoweraDiabetes2013Human β-cell killing by autoreactive preproinsulin-specific CD8 T cells is predominantly granule-mediated with the potency dependent upon T-cell receptor avidity.
22930221Simone Thomas; Sebastian Klobuch; Katrin Besold; Bodo Plachter; Jan Dörrie; Niels Schaft; Matthias Theobald; Wolfgang HerrEur J Immunol2012Strong and sustained effector function of memory- versus naïve-derived T cells upon T-cell receptor RNA transfer: implications for cellular therapy.
23272059Sylvia Borchers; Melanie Bremm; Thomas Lehrnbecher; Elke Dammann; Brigitte Pabst; Benno Wölk; Ruth Esser; Meral Yildiz; Matthias Eder; Michael Stadler; Peter Bader; Hans Martin; Andrea Jarisch; Gisbert Schneider; Thomas Klingebiel; Arnold Ganser; Eva M Weissinger; Ulrike KoehlPLoS One2012Sequential anti-cytomegalovirus response monitoring may allow prediction of cytomegalovirus reactivation after allogeneic stem cell transplantation.
23042025Fleur S Kleijwegt; Diahann T S L Jansen; Josefine Teeler; Antoinette M Joosten; Sandra Laban; Tatjana Nikolic; Bart O RoepEur J Immunol2013Tolerogenic dendritic cells impede priming of naïve CD8⁺ T cells and deplete memory CD8⁺ T cells.
23304188Eugene V Ravkov; Igor Y Pavlov; Kimberly E Hanson; Julio C DelgadoClin Dev Immunol2012Validation of cytomegalovirus immune competence assays for the characterization of CD8(+) T cell responses posttransplant.
23100361Julia Hesse; Stefanie Ameres; Katrin Besold; Steffi Krauter; Andreas Moosmann; Bodo PlachterJ Gen Virol2013Suppression of CD8+ T-cell recognition in the immediate-early phase of human cytomegalovirus infection.
23267020Dan Koning; Ana I Costa; Ilka Hoof; John J Miles; Nening M Nanlohy; Kristin Ladell; Katherine K Matthews; Vanessa Venturi; Ingrid M M Schellens; Jose A M Borghans; Can Kesmir; David A Price; Debbie van BaarleJ Immunol2013CD8+ TCR repertoire formation is guided primarily by the peptide component of the antigenic complex.
23405250Thi H O Nguyen; Glen P Westall; Tara E Bull; Aislin C Meehan; Nicole A Mifsud; Tom C KotsimbosPLoS One2013Cross-reactive anti-viral T cells increase prior to an episode of viral reactivation post human lung transplantation.
23424600Inmaculada Gayoso; Sara Cantisán; Carolina Cerrato; Joaquín Sánchez-García; Carmen Martin; Rafael Solana; Antonio Torres-Gomez; Julian Torre-CisnerosClin Dev Immunol2013Clinical factors influencing phenotype of HCMV-specific CD8+ T cells and HCMV-induced interferon-gamma production after allogeneic stem cells transplantation.
23483821Shao-An Xue; Liquan Gao; Maryam Ahmadi; Sara Ghorashian; Rafael D Barros; Constandina Pospori; Angelika Holler; Graham Wright; Sharyn Thomas; Max Topp; Emma C Morris; Hans J StaussOncoimmunology2013Human MHC Class I-restricted high avidity CD4<sup>+</sup> T cells generated by co-transfer of TCR and CD8 mediate efficient tumor rejection in vivo.
23449799Julia Hesse; Sabine Reyda; Stefan Tenzer; Katrin Besold; Nina Reuter; Steffi Krauter; Nicole Büscher; Thomas Stamminger; Bodo PlachterJ Virol2013Human cytomegalovirus pp71 stimulates major histocompatibility complex class i presentation of IE1-derived peptides at immediate early times of infection.
15597326Tania Crough; Jacqueline M Burrows; Chrysa Fazou; Susan Walker; Miles P Davenport; Rajiv KhannaEur J Immunol2005Contemporaneous fluctuations in T cell responses to persistent herpes virus infections.
15726667Michael Rist; Leanne Cooper; Rebecca Elkington; Susan Walker; Chrysa Fazou; Judy Tellam; Tania Crough; Rajiv KhannaEur J Immunol2005Ex vivo expansion of human cytomegalovirus-specific cytotoxic T cells by recombinant polyepitope: implications for HCMV immunotherapy.
19321758Eva Billerbeck; Nobuhiro Nakamoto; Bianca Seigel; Hubert E Blum; Kyong-Mi Chang; Robert ThimmeJ Gen Virol2009Determinants of in vitro expansion of different human virus-specific FoxP3+ regulatory CD8+ T cells in chronic hepatitis C virus infection.
12806278Uluhan Sili; M Helen Huls; Alan R Davis; Stephen Gottschalk; Malcolm K Brenner; Helen E Heslop; Cliona M RooneyJ Immunother2003Large-scale expansion of dendritic cell-primed polyclonal human cytotoxic T-lymphocyte lines using lymphoblastoid cell lines for adoptive immunotherapy.
12869514Maher K Gandhi; Mark R Wills; Georgina Okecha; Elizabeth K Day; Ray Hicks; Robert E Marcus; J G Patrick Sissons; Andrew J CarmichaelBlood2003Late diversification in the clonal composition of human cytomegalovirus-specific CD8+ T cells following allogeneic hemopoietic stem cell transplantation.
23636061Stephen J Griffiths; Natalie E Riddell; Joanne Masters; Valentina Libri; Sian M Henson; Anne Wertheimer; Diana Wallace; Stuart Sims; Laura Rivino; Anis Larbi; David M Kemeny; Janko Nikolich-Zugich; Florian Kern; Paul Klenerman; Vince C Emery; Arne N AkbarJ Immunol2013Age-associated increase of low-avidity cytomegalovirus-specific CD8+ T cells that re-express CD45RA.
12023339Mark R Wills; Georgina Okecha; Michael P Weekes; Maher K Gandhi; Patrick J G Sissons; Andrew J CarmichaelJ Immunol2002Identification of naive or antigen-experienced human CD8(+) T cells by expression of costimulation and chemokine receptors: analysis of the human cytomegalovirus-specific CD8(+) T cell response.
20100932Henry Radziewicz; Chris C Ibegbu; Huiming Hon; Nathalie Bédard; Julie Bruneau; Kimberly A Workowski; Stuart J Knechtle; Allan D Kirk; Christian P Larsen; Naglaa H Shoukry; Arash GrakouiJ Immunol2010Transient CD86 expression on hepatitis C virus-specific CD8+ T cells in acute infection is linked to sufficient IL-2 signaling.
22393125Oludare A Odumade; Jennifer A Knight; David O Schmeling; David Masopust; Henry H Balfour Jr; Kristin A HogquistJ Exp Med2012Primary Epstein-Barr virus infection does not erode preexisting CD8⁺ T cell memory in humans.
23142136Bianca Seigel; Bertram Bengsch; Volker Lohmann; Ralf Bartenschlager; Hubert E Blum; Robert ThimmeGastroenterology2013Factors that determine the antiviral efficacy of HCV-specific CD8(+) T cells ex vivo.
11717409N Azimi; M Nagai; S Jacobson; T A WaldmannProc Natl Acad Sci U S A2001IL-15 plays a major role in the persistence of Tax-specific CD8 cells in HAM/TSP patients.
18509087Yoshimi Enose-Akahata; Unsong Oh; Christian Grant; Steven JacobsonBlood2008Retrovirally induced CTL degranulation mediated by IL-15 expression and infection of mononuclear phagocytes in patients with HTLV-I-associated neurologic disease.
23717207Stefanie Ameres; Josef Mautner; Fabian Schlott; Michael Neuenhahn; Dirk H Busch; Bodo Plachter; Andreas MoosmannPLoS Pathog2013Presentation of an immunodominant immediate-early CD8+ T cell epitope resists human cytomegalovirus immunoevasion.
21541358Lishomwa C Ndhlovu; Fabio E Leal; Aaron M Hasenkrug; Aashish R Jha; Karina I Carvalho; Ijeoma G Eccles-James; Fernanda R Bruno; Raphaella G S Vieira; Vanessa A York; Glen M Chew; R Brad Jones; Yuetsu Tanaka; Walter K Neto; Sabri S Sanabani; Mario A Ostrowski; Aluisio C Segurado; Douglas F Nixon; Esper G KallasPLoS Negl Trop Dis2011HTLV-1 tax specific CD8+ T cells express low levels of Tim-3 in HTLV-1 infection: implications for progression to neurological complications.
23175378Pratip K Chattopadhyay; Kiprotich Chelimo; Paula B Embury; David H Mulama; Peter Odada Sumba; Emma Gostick; Kristin Ladell; Tess M Brodie; John Vulule; Mario Roederer; Ann M Moormann; David A PriceJ Virol2013Holoendemic malaria exposure is associated with altered Epstein-Barr virus-specific CD8(+) T-cell differentiation.
23787011Xin-Chao Wang; Hua Pang; Xun Xu; Anita Schmitt; Mathias Freund; Michael Schmitt; Bao-An ChenJ Formos Med Assoc2013Streptamer versus tetramer-based selection of functional cytomegalovirus-specific T cells.
23825303Magdalena Nauerth; Bianca Weißbrich; Robert Knall; Tobias Franz; Georg Dössinger; Jeannette Bet; Paulina J Paszkiewicz; Lukas Pfeifer; Mario Bunse; Wolfgang Uckert; Rafaela Holtappels; Dorothea Gillert-Marien; Michael Neuenhahn; Angela Krackhardt; Matthias J Reddehase; Stanley R Riddell; Dirk H BuschSci Transl Med2013TCR-ligand koff rate correlates with the protective capacity of antigen-specific CD8+ T cells for adoptive transfer.
23748502Evan W Newell; Natalia Sigal; Nitya Nair; Brian A Kidd; Harry B Greenberg; Mark M DavisNat Biotechnol2013Combinatorial tetramer staining and mass cytometry analysis facilitate T-cell epitope mapping and characterization.
23910932Anbing Liu; Yadan Ma; Wei Wu; Xiaoming Chen; Yaping Huang; Jianhua Hu; Hanying Liang; Huiqi Wang; Rong Yang; Jun FanJ Clin Virol2013Evaluation of human cytomegalovirus-specific CD8+ T-cells in allogeneic haematopoietic stem cell transplant recipients using pentamer and interferon-γ-enzyme-linked immunospot assays.
23280567Cynthia X L Chang; Anthony T Tan; Ming Yan Or; Kai Yee Toh; Pei Yiing Lim; Adeline S E Chia; Thomas M Froesig; Karen D Nadua; Hsueh-Ling J Oh; Hoe Nam Leong; Sine R Hadrup; Adam J Gehring; Yee-Joo Tan; Antonio Bertoletti; Gijsbert M GrotenbregEur J Immunol2013Conditional ligands for Asian HLA variants facilitate the definition of CD8+ T-cell responses in acute and chronic viral diseases.
23952609Ahmad Abu-Khader; Stefan KrauseEur J Haematol2013Rapid monitoring of immune reconstitution after allogeneic stem cell transplantation--a comparison of different assays for the detection of cytomegalovirus-specific T cells.
24371571Pauline Weder; Ton N M Schumacher; Hergen Spits; Rosalie M LuitenResults Immunol2012Testing for HLA/peptide tetramer-binding to the T cell receptor complex on human T lymphocytes.
23939944Irina Fernandez; Tracy P Ooi; Krishnendu RoyStem Cells2014Generation of functional, antigen-specific CD8+ human T cells from cord blood stem cells using exogenous Notch and tetramer-TCR signaling.
23963968François Legoux; Laetitia Gautreau; Leslie Hesnard; Alexandra Leger; Melinda Moyon; Marie-Claire Devilder; Marc Bonneville; Xavier SaulquinEur J Immunol2013Characterization of the human CD4(+) T-cell repertoire specific for major histocompatibility class I-restricted antigens.
24309405Xiaoyan Pan; Li-Chieh Huang; Tao Dong; Yanchun Peng; Vincenzo Cerundolo; Simon McGowan; Graham OggJ Immunol Methods2014Combinatorial HLA-peptide bead libraries for high throughput identification of CD8⁺ T cell specificity.
12805061Genovefa A Papanicolaou; Jean-Baptiste Latouche; Cuiwen Tan; Jakob Dupont; Jeffrey Stiles; Eric G Pamer; Michel SadelainBlood2003Rapid expansion of cytomegalovirus-specific cytotoxic T lymphocytes by artificial antigen-presenting cells expressing a single HLA allele.
18600178Yuriko Fujita; Ann M Leen; Jiali Sun; Yozo Nakazawa; Eric Yvon; Helen E Heslop; Malcolm K Brenner; Cliona M RooneyJ Immunother2008Exploiting cytokine secretion to rapidly produce multivirus-specific T cells for adoptive immunotherapy.
25108651Marcus Odendahl; G Ulrich Grigoleit; Halvard Bönig; Michael Neuenhahn; Julia Albrecht; Florian Anderl; Lothar Germeroth; Marc Schmitz; Martin Bornhäuser; Hermann Einsele; Erhard Seifried; Dirk H Busch; Torsten TonnCytotherapy2014Clinical-scale isolation of 'minimally manipulated' cytomegalovirus-specific donor lymphocytes for the treatment of refractory cytomegalovirus disease.
25008925Susanne Ziegler; Kathrin Skibbe; Andreas Walker; Xiaoyu Ke; Falko M Heinemann; Andreas Heinold; Juk Yee Mok; Wim J E van Esch; Dongliang Yang; Matthias Wölfl; Jörg TimmJ Virol2014Impact of sequence variation in a dominant HLA-A*02-restricted epitope in hepatitis C virus on priming and cross-reactivity of CD8+ T cells.
Michael Rasmussen M.Sc; Mikkel Nors Harndahl Ph.D.; Anne Bregnballe Kristensen B.Sc.; Ida Kallehauge Nielsen B.Sc.; Kasper W Jorgensen Ph.D.; Anette Stryhn Ph.D.; Morten Nielsen Ph.D.; Sören Buus Buus MD, Ph.D.2014Large scale analysis of peptide - HLA-I stability
25043392Caroline Aspord; Claire Leloup; Sabine Reche; Joel PlumasEur J Immunol2014pDCs efficiently process synthetic long peptides to induce functional virus- and tumour-specific T-cell responses.
25311806Rieuwert Hoppes; Rimke Oostvogels; Jolien J Luimstra; Kim Wals; Mireille Toebes; Laura Bies; Reggy Ekkebus; Pramila Rijal; Patrick H N Celie; Julie H Huang; Maarten E Emmelot; Robbert M Spaapen; Henk Lokhorst; Ton N M Schumacher; Tuna Mutis; Boris Rodenko; Huib OvaaJ Immunol2014Altered peptide ligands revisited: vaccine design through chemically modified HLA-A2-restricted T cell epitopes.
25227910G Malcherek; N Jin; A G Hückelhoven; J Mani; L Wang; U Gern; A Diehlmann; P Wuchter; A Schmitt; B Chen; A D Ho; M SchmittLeukemia2014Mesenchymal stromal cells inhibit proliferation of virus-specific CD8(+) T cells.
25505266Chopie Hassan; Eric Chabrol; Lorenz Jahn; Michel G D Kester; Arnoud H de Ru; Jan W Drijfhout; Jamie Rossjohn; J H Frederik Falkenburg; Mirjam H M Heemskerk; Stephanie Gras; Peter A van VeelenJ Biol Chem2015Naturally processed non-canonical HLA-A*02:01 presented peptides.
25392532Jean-Baptiste Reiser; François Legoux; Stéphanie Gras; Eric Trudel; Anne Chouquet; Alexandra Léger; Madalen Le Gorrec; Paul Machillot; Marc Bonneville; Xavier Saulquin; Dominique HoussetJ Immunol2014Analysis of relationships between peptide/MHC structural features and naive T cell frequency in humans.
25658615Nobuhiko Imahashi; Tetsuya Nishida; Tatsunori Goto; Seitaro Terakura; Keisuke Watanabe; Ryo Hanajiri; Reona Sakemura; Misa Imai; Hitoshi Kiyoi; Tomoki Naoe; Makoto MurataJ Immunother2015Simple and efficient generation of virus-specific T cells for adoptive therapy using anti-4-1BB antibody.
25249579Ania Skowera; Kristin Ladell; James E McLaren; Garry Dolton; Katherine K Matthews; Emma Gostick; Deborah Kronenberg-Versteeg; Martin Eichmann; Robin R Knight; Susanne Heck; Jake Powrie; Polly J Bingley; Colin M Dayan; John J Miles; Andrew K Sewell; David A Price; Mark PeakmanDiabetes2015β-cell-specific CD8 T cell phenotype in type 1 diabetes reflects chronic autoantigen exposure.
25314332Natalie E Riddell; Stephen J Griffiths; Laura Rivino; David C B King; Guo H Teo; Sian M Henson; Sara Cantisan; Rafael Solana; David M Kemeny; Paul A MacAry; Anis Larbi; Arne N AkbarImmunology2015Multifunctional cytomegalovirus (CMV)-specific CD8(+) T cells are not restricted by telomere-related senescence in young or old adults.
25348595Joanna A L Choo; Sock Yue Thong; Jiawei Yap; Wim J E van Esch; Manfred Raida; Rob Meijers; Julien Lescar; Steven H L Verhelst; Gijsbert M GrotenbregAngew Chem Int Ed Engl2014Bioorthogonal cleavage and exchange of major histocompatibility complex ligands by employing azobenzene-containing peptides.
25717102Michiel C van Aalderen; Ester B M Remmerswaal; Niels J M Verstegen; Pleun Hombrink; Anja ten Brinke; Hanspeter Pircher; Neeltje A Kootstra; Ineke J M ten Berge; René A W van LierJ Virol2015Infection history determines the differentiation state of human CD8+ T cells.
25589627Pleun Hombrink; Chopie Hassan; Michel G D Kester; Lorenz Jahn; Margot J Pont; Arnoud H de Ru; Cornelis A M van Bergen; Marieke Griffioen; J H Frederik Falkenburg; Peter A van Veelen; Mirjam H M HeemskerkClin Cancer Res2015Identification of Biological Relevant Minor Histocompatibility Antigens within the B-lymphocyte-Derived HLA-Ligandome Using a Reverse Immunology Approach.
25925682Patrick J Hanley; Jan J Melenhorst; Sarah Nikiforow; Phillip Scheinberg; James W Blaney; Gail Demmler-Harrison; C Russell Cruz; Sharon Lam; Robert A Krance; Kathryn S Leung; Caridad A Martinez; Hao Liu; Daniel C Douek; Helen E Heslop; Cliona M Rooney; Elizabeth J Shpall; A John Barrett; John R Rodgers; Catherine M BollardSci Transl Med2015CMV-specific T cells generated from naïve T cells recognize atypical epitopes and may be protective in vivo.
25992863Wong Yu; Ning Jiang; Peter J R Ebert; Brian A Kidd; Sabina Müller; Peder J Lund; Jeremy Juang; Keishi Adachi; Tiffany Tse; Michael E Birnbaum; Evan W Newell; Darrell M Wilson; Gijsbert M Grotenbreg; Salvatore Valitutti; Stephen R Quake; Mark M DavisImmunity2015Clonal Deletion Prunes but Does Not Eliminate Self-Specific αβ CD8(+) T Lymphocytes.
26113847Solomon Owusu Sekyere; Pothakamuri Venkata Suneetha; Svenja Hardtke; Christine Susanne Falk; Julia Hengst; Michael Peter Manns; Markus Cornberg; Heiner Wedemeyer; Verena SchlaphoffFront Immunol2015Type I Interferon Elevates Co-Regulatory Receptor Expression on CMV- and EBV-Specific CD8 T Cells in Chronic Hepatitis C.
26181057Simone Thomas; Sebastian Klobuch; Jürgen Podlech; Bodo Plachter; Petra Hoffmann; Angelique Renzaho; Matthias Theobald; Matthias J Reddehase; Wolfgang Herr; Niels A W LemmermannPLoS Pathog2015Evaluating Human T-Cell Therapy of Cytomegalovirus Organ Disease in HLA-Transgenic Mice.
25838392Xiuli Wang; ChingLam W Wong; Ryan Urak; Armen Mardiros; Lihua E Budde; Wen-Chung Chang; Sandra H Thomas; Christine E Brown; Corinna La Rosa; Don J Diamond; Michael C Jensen; Ryotaro Nakamura; John A Zaia; Stephen J FormanClin Cancer Res2015CMVpp65 Vaccine Enhances the Antitumor Efficacy of Adoptively Transferred CD19-Redirected CMV-Specific T Cells.
26041301Shihong Zhang; Rakesh K Bakshi; Pothakamuri Venkata Suneetha; Paraskevi Fytili; Dinler A Antunes; Gustavo F Vieira; Roland Jacobs; Christoph S Klade; Michael P Manns; Anke R M Kraft; Heiner Wedemeyer; Verena Schlaphoff; Markus CornbergJ Virol2015Frequency, Private Specificity, and Cross-Reactivity of Preexisting Hepatitis C Virus (HCV)-Specific CD8+ T Cells in HCV-Seronegative Individuals: Implications for Vaccine Responses.
25339770Ester B M Remmerswaal; Paul L Klarenbeek; Nuno L Alves; Marieke E Doorenspleet; Barbera D C van Schaik; Rebecca E E Esveldt; Mirza M Idu; Ester M M van Leeuwen; Nelly van der Bom-Baylon; Antoine H C van Kampen; Sven D Koch; Hanspeter Pircher; Frederike J Bemelman; Anja Ten Brinke; Frank Baas; Ineke J M Ten Berge; Rene A W van Lier; Niek de VriesJ Virol2015Clonal evolution of CD8+ T cell responses against latent viruses: relationship among phenotype, localization, and function.
26028505Guenther Koehne; Aisha Hasan; Ekaterina Doubrovina; Susan Prockop; Eleanor Tyler; Gloria Wasilewski; Richard J O'ReillyBiol Blood Marrow Transplant2015Immunotherapy with Donor T Cells Sensitized with Overlapping Pentadecapeptides for Treatment of Persistent Cytomegalovirus Infection or Viremia.
26492414Suzanne E Brooks; Stephanie A Bonney; Cindy Lee; Amy Publicover; Ghazala Khan; Evelien L Smits; Dagmar Sigurdardottir; Matthew Arno; Demin Li; Ken I Mills; Karen Pulford; Alison H Banham; Viggo van Tendeloo; Ghulam J Mufti; Hans-Georg Rammensee; Tim J Elliott; Kim H Orchard; Barbara-ann GuinnPLoS One2015Application of the pMHC Array to Characterise Tumour Antigen Specific T Cell Populations in Leukaemia Patients at Disease Diagnosis.
26429912Xinbo Yang; Mingming Gao; Guobing Chen; Brian G Pierce; Jinghua Lu; Nan-Ping Weng; Roy A MariuzzaJ Biol Chem2015Structural Basis for Clonal Diversity of the Public T Cell Response to a Dominant Human Cytomegalovirus Epitope.
25761891Laura Rivino; Emmanuelle A Kumaran; Tun-Linn Thein; Chien Tei Too; Victor Chih Hao Gan; Brendon J Hanson; Annelies Wilder-Smith; Antonio Bertoletti; Nicholas R J Gascoigne; David Chien Lye; Yee Sin Leo; Arne N Akbar; David M Kemeny; Paul A MacArySci Transl Med2015Virus-specific T lymphocytes home to the skin during natural dengue infection.
26603974K M Heutinck; S L Yong; L Tonneijck; H van den Heuvel; N C van der Weerd; K A M I van der Pant; F J Bemelman; F H J Claas; I J M Ten BergeAm J Transplant2016Virus-Specific CD8(+) T Cells Cross-Reactive to Donor-Alloantigen Are Transiently Present in the Circulation of Kidney Transplant Recipients Infected With CMV and/or EBV.
27138093Hebun Erdur; Veronika Scholz; Mathias Streitz; Markus Hammer; Christian Meisel; Constanze Schönemann; Klaus-Peter Wandinger; Berit RoscheJ Neuroimmunol2016EBNA1 antigen-specific CD8+ T cells in cerebrospinal fluid of patients with multiple sclerosis.
26800118C S Link; A Eugster; F Heidenreich; E Rücker-Braun; M Schmiedgen; U Oelschlägel; D Kühn; S Dietz; Y Fuchs; A Dahl; A M J Domingues; C Klesse; M Schmitz; G Ehninger; M Bornhäuser; J Schetelig; E BonifacioClin Exp Immunol2016Abundant cytomegalovirus (CMV) reactive clonotypes in the CD8(+) T cell receptor alpha repertoire following allogeneic transplantation.
26509579Mark Klinger; Francois Pepin; Jen Wilkins; Thomas Asbury; Tobias Wittkop; Jianbiao Zheng; Martin Moorhead; Malek FahamPLoS One2015Multiplex Identification of Antigen-Specific T Cell Receptors Using a Combination of Immune Assays and Immune Receptor Sequencing.
26033882Thomas Mørch Frøsig; Jiawei Yap; Tina Seremet; Rikke Lyngaa; Inge Marie Svane; Per Thor Straten; Mirjam H M Heemskerk; Gijsbert M Grotenbreg; Sine Reker HadrupCytometry A2015Design and validation of conditional ligands for HLA-B*08:01, HLA-B*15:01, HLA-B*35:01, and HLA-B*44:05.
26846725Barbara Szomolay; Jie Liu; Paul E Brown; John J Miles; Mathew Clement; Sian Llewellyn-Lacey; Garry Dolton; Julia Ekeruche-Makinde; Anya Lissina; Andrea J Schauenburg; Andrew K Sewell; Scott R Burrows; Mario Roederer; David A Price; Linda Wooldridge; Hugo A van den BergImmunol Cell Biol2016Identification of human viral protein-derived ligands recognized by individual MHCI-restricted T-cell receptors.
27411667Victoria Hillerdal; Vanessa F Boura; Hanna Björkelund; Karl Andersson; Magnus EssandBMC Immunol2016Avidity characterization of genetically engineered T-cells with novel and established approaches.
27484900David Bernal-Estévez; Ramiro Sánchez; Rafael E Tejada; Carlos Parra-LópezBMC Cancer2016Chemotherapy and radiation therapy elicits tumor specific T cell responses in a breast cancer patient.
27279616Corey Smith; Rebekah M Brennan; Siok-Keen Tey; Mark J Smyth; Scott R Burrows; John J Miles; Geoffrey R Hill; Rajiv KhannaJ Virol2016Coinfection with Human Cytomegalovirus Genetic Variants in Transplant Recipients and Its Impact on Antiviral T Cell Immune Reconstitution.
27606351Vijayendra Dasari; Andrea Schuessler; Corey Smith; Yide Wong; John J Miles; Mark J Smyth; George Ambalathingal; Ross Francis; Scott Campbell; Daniel Chambers; Rajiv KhannaMol Ther Methods Clin Dev2016Prophylactic and therapeutic adenoviral vector-based multivirus-specific T-cell immunotherapy for transplant patients.
27717382Sabine Tischer; René Geyeregger; Julian Kwoczek; Albert Heim; Constanca Figueiredo; Rainer Blasczyk; Britta Maecker-Kolhoff; Britta Eiz-VesperJ Transl Med2016Discovery of immunodominant T-cell epitopes reveals penton protein as a second immunodominant target in human adenovirus infection.
28011931Satomi Ando; Atsuhiko Hasegawa; Yuji Murakami; Na Zeng; Natsuko Takatsuka; Yasuhiro Maeda; Takao Masuda; Youko Suehiro; Mari KannagiJ Immunol2017HTLV-1 Tax-Specific CTL Epitope-Pulsed Dendritic Cell Therapy Reduces Proviral Load in Infected Rats with Immune Tolerance against Tax.
28423320Guobing Chen; Xinbo Yang; Annette Ko; Xiaoping Sun; Mingming Gao; Yongqing Zhang; Alvin Shi; Roy A Mariuzza; Nan-Ping WengCell Rep2017Sequence and Structural Analyses Reveal Distinct and Highly Diverse Human CD8<sup>+</sup> TCR Repertoires to Immunodominant Viral Antigens.
28623251Takahiko Miyama; Takakazu Kawase; Kazutaka Kitaura; Ren Chishaki; Masashi Shibata; Kumi Oshima; Hiroshi Hamana; Hiroyuki Kishi; Atsushi Muraguchi; Kiyotaka Kuzushima; Hiroh Saji; Tadasu Shin-I; Ryuji Suzuki; Tatsuo IchinoheSci Rep2017Highly functional T-cell receptor repertoires are abundant in stem memory T cells and highly shared among individuals.
16237109Lydie Trautmann; Marie Rimbert; Klara Echasserieau; Xavier Saulquin; Bérangère Neveu; Julie Dechanet; Vincenzo Cerundolo; Marc BonnevilleJ Immunol2005Selection of T cell clones expressing high-affinity public TCRs within Human cytomegalovirus-specific CD8 T cell responses.
16287711David A Price; Jason M Brenchley; Laura E Ruff; Michael R Betts; Brenna J Hill; Mario Roederer; Richard A Koup; Steven A Migueles; Emma Gostick; Linda Wooldridge; Andrew K Sewell; Mark Connors; Daniel C DouekJ Exp Med2005Avidity for antigen shapes clonal dominance in CD8+ T cell populations specific for persistent DNA viruses.
21555537Isabelle Miconnet; Angélique Marrau; Alex Farina; Patrick Taffé; Selena Vigano; Alexandre Harari; Giuseppe PantaleoJ Immunol2011Large TCR diversity of virus-specific CD8 T cells provides the mechanistic basis for massive TCR renewal after antigen exposure.
25576336Sally A Hunsucker; Colleen S McGary; Benjamin G Vincent; Atim A Enyenihi; Jennifer P Waugh; Karen P McKinnon; Lisa M Bixby; Patricia A Ropp; James M Coghill; William A Wood; Don A Gabriel; Stefanie Sarantopoulos; Thomas C Shea; Jonathan S Serody; Gheath Alatrash; Tania Rodriguez-Cruz; Gregory Lizée; Adam S Buntzman; Jeffrey A Frelinger; Gary L Glish; Paul M ArmisteadCancer Immunol Res2015Peptide/MHC tetramer-based sorting of CD8⁺ T cells to a leukemia antigen yields clonotypes drawn nonspecifically from an underlying restricted repertoire.
28636589Jacob Glanville; Huang Huang; Allison Nau; Olivia Hatton; Lisa E Wagar; Florian Rubelt; Xuhuai Ji; Arnold Han; Sheri M Krams; Christina Pettus; Nikhil Haas; Cecilia S Lindestam Arlehamn; Alessandro Sette; Scott D Boyd; Thomas J Scriba; Olivia M Martinez; Mark M DavisNature2017Identifying specificity groups in the T cell receptor repertoire.
28636592Pradyot Dash; Andrew J Fiore-Gartland; Tomer Hertz; George C Wang; Shalini Sharma; Aisha Souquette; Jeremy Chase Crawford; E Bridie Clemens; Thi H O Nguyen; Katherine Kedzierska; Nicole L La Gruta; Philip Bradley; Paul G ThomasNature2017Quantifiable predictive features define epitope-specific T cell receptor repertoires.
28717478Julie D McIntosh; Margaret A Brimble; Anna E S Brooks; P Rod Dunbar; Renata Kowalczyk; Yusuke Tomabechi; Antony J FairbanksChem Sci2015Convergent chemo-enzymatic synthesis of mannosylated glycopeptides; targeting of putative vaccine candidates to antigen presenting cells.
28630092Justyna Ogonek; Kriti Verma; Christian Schultze-Florey; Pavankumar Varanasi; Susanne Luther; Patrick Schweier; Wolfgang Kühnau; Gudrun Göhring; Elke Dammann; Michael Stadler; Arnold Ganser; Ulrike Koehl; Christian Koenecke; Eva M Weissinger; Lothar HambachJ Immunol2017Characterization of High-Avidity Cytomegalovirus-Specific T Cells with Differential Tetramer Binding Coappearing after Allogeneic Stem Cell Transplantation.
25852054Yvonne Suessmuth; Rithun Mukherjee; Benjamin Watkins; Divya T Koura; Knut Finstermeier; Cindy Desmarais; Linda Stempora; John T Horan; Amelia Langston; Muna Qayed; Hanna J Khoury; Audrey Grizzle; Jennifer A Cheeseman; Jason A Conger; Jennifer Robertson; Aneesah Garrett; Allan D Kirk; Edmund K Waller; Bruce R Blazar; Aneesh K Mehta; Harlan S Robins; Leslie S KeanBlood2015CMV reactivation drives posttransplant T-cell reconstitution and results in defects in the underlying TCRβ repertoire.
28818566Ellen K Link; Christine Brandmüller; Yasemin Suezer; Stefanie Ameres; Asisa Volz; Andreas Moosmann; Gerd Sutter; Michael H LehmannVaccine2017A synthetic human cytomegalovirus pp65-IE1 fusion antigen efficiently induces and expands virus specific T cells.
28564390Andreas Fløe; Caroline Løppke; Ole Hilberg; Christian Wejse; Liselotte Brix; Kivin JacobsenImmunology2017Development of an epitope panel for consistent identification of antigen-specific T-cells in humans.
28934479Shaked Afik; Kathleen B Yates; Kevin Bi; Samuel Darko; Jernej Godec; Ulrike Gerdemann; Leo Swadling; Daniel C Douek; Paul Klenerman; Eleanor J Barnes; Arlene H Sharpe; W Nicholas Haining; Nir YosefNucleic Acids Res2017Targeted reconstruction of T cell receptor sequence from single cell RNA-seq links CDR3 length to T cell differentiation state.
28652156Britta Furtmann; Justin Tang; Sven Kramer; Thomas Eickner; Frank Luderer; Gert Fricker; Alessandro Gomez; Bianca Heemskerk; Peter S JähnJ Pharm Sci2017Electrospray Synthesis of Poly(lactide-co-glycolide) Nanoparticles Encapsulating Peptides to Enhance Proliferation of Antigen-Specific CD8<sup>+</sup> T Cells.
29079845M Speir; A Authier-Hall; C R Brooks; K J Farrand; B J Compton; R J Anderson; A Heiser; T L Osmond; C W Tang; J A Berzofsky; M Terabe; G F Painter; I F Hermans; R WeinkoveSci Rep2017Glycolipid-peptide conjugate vaccines enhance CD8<sup>+</sup> T cell responses against human viral proteins.
28975614Amandine Bovay; Vincent Zoete; Garry Dolton; Anna M Bulek; David K Cole; Pierre J Rizkallah; Anna Fuller; Konrad Beck; Olivier Michielin; Daniel E Speiser; Andrew K Sewell; Silvia A Fuertes MarracoEur J Immunol2018T cell receptor alpha variable 12-2 bias in the immunodominant response to Yellow fever virus.
29232408Amna Malik; Emily Adland; Leana Laker; Henrik Kløverpris; Rabiah Fardoos; Julia Roider; Mai C Severinsen; Fabian Chen; Lynn Riddell; Anne Edwards; Søren Buus; Pieter Jooste; Philippa C Matthews; Philip J R GoulderPLoS One2017Immunodominant cytomegalovirus-specific CD8+ T-cell responses in sub-Saharan African populations.
17709536Elizabeth K Day; Andrew J Carmichael; Ineke J M ten Berge; Edward C P Waller; J G Patrick Sissons; Mark R WillsJ Immunol2007Rapid CD8+ T cell repertoire focusing and selection of high-affinity clones into memory following primary infection with a persistent human virus: human cytomegalovirus.
24069285Mark Klinger; Katherine Kong; Martin Moorhead; Li Weng; Jianbiao Zheng; Malek FahamPLoS One2013Combining next-generation sequencing and immune assays: a novel method for identification of antigen-specific T cells.
25801351Michelle A Neller; Kristin Ladell; James E McLaren; Katherine K Matthews; Emma Gostick; Johanne M Pentier; Garry Dolton; Andrea J A Schauenburg; Dan Koning; Ana Isabel C A Fontaine Costa; Thomas S Watkins; Vanessa Venturi; Corey Smith; Rajiv Khanna; Kelly Miners; Mathew Clement; Linda Wooldridge; David K Cole; Debbie van Baarle; Andrew K Sewell; Scott R Burrows; David A Price; John J MilesImmunol Cell Biol2015Naive CD8⁺ T-cell precursors display structured TCR repertoires and composite antigen-driven selection dynamics.
29196783Eddie A James; Joana R F Abreu; John W McGinty; Jared M Odegard; Yvonne E Fillié; Claire N Hocter; Slobodan Culina; Kristin Ladell; David A Price; Aimon Alkanani; Marynette Rihanek; Lisa Fitzgerald-Miller; Ania Skowera; Cate Speake; Peter Gottlieb; Howard W Davidson; F Susan Wong; Bart Roep; Roberto Mallone; Immunology of Diabetes Society T Cell Workshop CommitteeDiabetologia2018Combinatorial detection of autoreactive CD8<sup>+</sup> T cells with HLA-A2 multimers: a multi-centre study by the Immunology of Diabetes Society T Cell Workshop.
29709038Nicolas Jouand; Céline Bressollette-Bodin; Nathalie Gérard; Magali Giral; Pierrick Guérif; Audrey Rodallec; Romain Oger; Tiphaine Parrot; Mathilde Allard; Anne Cesbron-Gautier; Nadine Gervois; Béatrice CharreauPLoS Pathog2018HCMV triggers frequent and persistent UL40-specific unconventional HLA-E-restricted CD8 T-cell responses with potential autologous and allogeneic peptide recognition.
29666167Jolien J Luimstra; Malgorzata A Garstka; Marthe C J Roex; Anke Redeker; George M C Janssen; Peter A van Veelen; Ramon Arens; J H Frederik Falkenburg; Jacques Neefjes; Huib OvaaJ Exp Med2018A flexible MHC class I multimer loading system for large-scale detection of antigen-specific T cells.
29653982Kotaro Miyao; Seitaro Terakura; Shingo Okuno; Jakrawadee Julamanee; Keisuke Watanabe; Hiroshi Hamana; Hiroyuki Kishi; Reona Sakemura; Daisuke Koyama; Tatsunori Goto; Tetsuya Nishida; Makoto Murata; Hitoshi KiyoiCancer Immunol Res2018Introduction of Genetically Modified CD3ζ Improves Proliferation and Persistence of Antigen-Specific CTLs.
29844168Stoyan Dimitrov; Cécile Gouttefangeas; Luciana Besedovsky; Anja T R Jensen; P Anoop Chandran; Elisa Rusch; Ramona Businger; Michael Schindler; Tanja Lange; Jan Born; Hans-Georg RammenseeProc Natl Acad Sci U S A2018Activated integrins identify functional antigen-specific CD8<sup>+</sup> T cells within minutes after antigen stimulation.
29669837Hadi Karimzadeh; Muthamia M Kiraithe; Anna D Kosinska; Manuel Glaser; Melanie Fiedler; Valerie Oberhardt; Elahe Salimi Alizei; Maike Hofmann; Juk Yee Mok; Melanie Nguyen; Wim J E van Esch; Bettina Budeus; Jan Grabowski; Maria Homs; Antonella Olivero; Hossein Keyvani; Francisco Rodríguez-Frías; David Tabernero; Maria Buti; Andreas Heinold; Seyed Moayed Alavian; Tanja Bauer; Julian Schulze Zur Wiesch; Bijan Raziorrouh; Daniel Hoffmann; Antonina Smedile; Mario Rizzetto; Heiner Wedemeyer; Jörg Timm; Iris Antes; Christoph Neumann-Haefelin; Ulrike Protzer; Michael RoggendorfJ Virol2018Amino Acid Substitutions within HLA-B*27-Restricted T Cell Epitopes Prevent Recognition by Hepatitis Delta Virus-Specific CD8<sup>+</sup> T Cells.
29735483Louise C Rowntree; Thi H O Nguyen; Hanim Halim; Anthony W Purcell; Jamie Rossjohn; Stephanie Gras; Tom C Kotsimbos; Nicole A MifsudJ Immunol2018Inability To Detect Cross-Reactive Memory T Cells Challenges the Frequency of Heterologous Immunity among Common Viruses.
29752315Erika A K Fletcher; Wendy van Maren; Robert Cordfunke; Jasper Dinkelaar; Jeroen D C Codee; Gijs van der Marel; Cornelis J M Melief; Ferry Ossendorp; Jan Wouter Drijfhout; Sara M MangsboJ Immunol2018Formation of Immune Complexes with a Tetanus-Derived B Cell Epitope Boosts Human T Cell Responses to Covalently Linked Peptides in an Ex Vivo Blood Loop System.
30008714Garry Dolton; Efthalia Zervoudi; Cristina Rius; Aaron Wall; Hannah L Thomas; Anna Fuller; Lorraine Yeo; Mateusz Legut; Sophie Wheeler; Meriem Attaf; Dmitriy M Chudakov; Ernest Choy; Mark Peakman; Andrew K SewellFront Immunol2018Optimized Peptide-MHC Multimer Protocols for Detection and Isolation of Autoimmune T-Cells.
29851415Lorraine Yeo; Alyssa Woodwyk; Sanjana Sood; Anna Lorenc; Martin Eichmann; Irma Pujol-Autonell; Rosella Melchiotti; Ania Skowera; Efthymios Fidanis; Garry M Dolton; Katie Tungatt; Andrew K Sewell; Susanne Heck; Alka Saxena; Craig A Beam; Mark PeakmanJ Clin Invest2018Autoreactive T effector memory differentiation mirrors β cell function in type 1 diabetes.
30009488Y Eiraku; H Terunuma; M Yagi; X Deng; A J Nicol; M NiedaClin Exp Immunol2018Dendritic cells cross-talk with tumour antigen-specific CD8<sup>+</sup> T cells, Vγ9γδT cells and Vα24NKT cells in patients with glioblastoma multiforme and in healthy donors.
22031866Seitaro Terakura; Tori N Yamamoto; Rebecca A Gardner; Cameron J Turtle; Michael C Jensen; Stanley R RiddellBlood2012Generation of CD19-chimeric antigen receptor modified CD8+ T cells derived from virus-specific central memory T cells.
11418651J M Faint; N E Annels; S J Curnow; P Shields; D Pilling; A D Hislop; L Wu; A N Akbar; C D Buckley; P A Moss; D H Adams; A B Rickinson; M SalmonJ Immunol2001Memory T cells constitute a subset of the human CD8+CD45RA+ pool with distinct phenotypic and migratory characteristics.
14734757Michaela Lucas; Ana L Vargas-Cuero; Georg M Lauer; Eleanor Barnes; Christian B Willberg; Nasser Semmo; Bruce D Walker; Rodney Phillips; Paul KlenermanJ Immunol2004Pervasive influence of hepatitis C virus on the phenotype of antiviral CD8+ T cells.
25525252Yuka Maeda; Hiroyoshi Nishikawa; Daisuke Sugiyama; Danbee Ha; Masahide Hamaguchi; Takuro Saito; Megumi Nishioka; James B Wing; Dennis Adeegbe; Ichiro Katayama; Shimon SakaguchiScience2014Detection of self-reactive CD8⁺ T cells with an anergic phenotype in healthy individuals.
26314621Kathrin Rothe; Dagmar Quandt; Kristin Schubert; Manuela Rossol; Maria Klingner; Simon Jasinski-Bergner; Roger Scholz; Barbara Seliger; Matthias Pierer; Christoph Baerwald; Ulf WagnerArthritis Rheumatol2016Latent Cytomegalovirus Infection in Rheumatoid Arthritis and Increased Frequencies of Cytolytic LIR-1+CD8+ T Cells.
25338522Joseph D Tario Jr; George L Chen; Theresa E Hahn; Dalin Pan; Rosemary L Furlage; Yali Zhang; Liselotte Brix; Charlotte Halgreen; Kivin Jacobsen; Philip L McCarthy; Paul K WallaceCytometry B Clin Cytom2015Dextramer reagents are effective tools for quantifying CMV antigen-specific T cells from peripheral blood samples.
23271411Kazuhiro Ikegame; Ruri Kato; Tatsuya Fujioka; Masaya Okada; Katsuji Kaida; Shinichi Ishii; Satoshi Yoshihara; Takayuki Inoue; Kyoko Taniguchi; Hiroya Tamaki; Toshihiro Soma; Hiroyasu OgawaInt J Hematol2013Detection of donor-derived CMV-specific T cells in cerebrospinal fluid in a case of CMV meningoencephalitis after cord blood stem cell transplantation.
16968899Mirjam H M Heemskerk; Renate S Hagedoorn; Menno A W G van der Hoorn; Lars T van der Veken; Manja Hoogeboom; Michel G D Kester; Roel Willemze; J H Frederik FalkenburgBlood2007Efficiency of T-cell receptor expression in dual-specific T cells is controlled by the intrinsic qualities of the TCR chains within the TCR-CD3 complex.
16357839L Hambach; B A Nijmeijer; Z Aghai; M L J van Schie; M H M Wauben; J H F Falkenburg; E GoulmyLeukemia2006Human cytotoxic T lymphocytes specific for a single minor histocompatibility antigen HA-1 are effective against human lymphoblastic leukaemia in NOD/scid mice.
15162426Eleanor Barnes; Scott M Ward; Victoria O Kasprowicz; Geoffrey Dusheiko; Paul Klenerman; Michaela LucasEur J Immunol2004Ultra-sensitive class I tetramer analysis reveals previously undetectable populations of antiviral CD8+ T cells.
28369038Ryan O Emerson; William S DeWitt; Marissa Vignali; Jenna Gravley; Joyce K Hu; Edward J Osborne; Cindy Desmarais; Mark Klinger; Christopher S Carlson; John A Hansen; Mark Rieder; Harlan S RobinsNat Genet2017Immunosequencing identifies signatures of cytomegalovirus exposure history and HLA-mediated effects on the T cell repertoire.
29151581Tomonori Yaguchi; Asuka Kobayashi; Takashi Inozume; Kenji Morii; Haruna Nagumo; Hiroshi Nishio; Takashi Iwata; Yuyo Ka; Ikumi Katano; Ryoji Ito; Mamoru Ito; Yutaka KawakamiCell Mol Immunol2018Human PBMC-transferred murine MHC class I/II-deficient NOG mice enable long-term evaluation of human immune responses.
29208744Nuray Aslan; Levi B Watkin; Anna Gil; Rabinarayan Mishra; Fransenio G Clark; Raymond M Welsh; Dario Ghersi; Katherine Luzuriaga; Liisa K SelinMBio2017Severity of Acute Infectious Mononucleosis Correlates with Cross-Reactive Influenza CD8 T-Cell Receptor Repertoires.
30418433Shu-Qi Zhang; Ke-Yue Ma; Alexandra A Schonnesen; Mingliang Zhang; Chenfeng He; Eric Sun; Chad M Williams; Weiping Jia; Ning JiangNat Biotechnol2018High-throughput determination of the antigen specificities of T cell receptors in single cells.
30777378Ilenia Cammarata; Carmela Martire; Alessandra Citro; Domenico Raimondo; Doriana Fruci; Ombretta Melaiu; Valentina D'Oria; Chiara Carone; Giovanna Peruzzi; Cristina Cerboni; Angela Santoni; John Sidney; Alessandro Sette; Marino Paroli; Rosalba Caccavale; Edoardo Milanetti; Mara Riminucci; Eleonora Timperi; Silvia Piconese; Antonio Manzo; Carlomaurizio Montecucco; Rossana Scrivo; Guido Valesini; Elisabetta Cariani; Vincenzo BarnabaJ Autoimmun2019Counter-regulation of regulatory T cells by autoreactive CD8<sup>+</sup> T cells in rheumatoid arthritis.
30562587Corinna La Rosa; Jeffrey Longmate; Chetan Raj Lingaraju; Qiao Zhou; Teodora Kaltcheva; Nicola Hardwick; Ibrahim Aldoss; Ryotaro Nakamura; Don J DiamondBiol Blood Marrow Transplant2019Rapid Acquisition of Cytomegalovirus-Specific T Cells with a Differentiated Phenotype, in Nonviremic Hematopoietic Stem Transplant Recipients Vaccinated with CMVPepVax.
31105703Asma Khanniche; Ling Zhou; Bin Jiang; Jing Song; Yanhua Jin; Jian Yin; Shujun Wang; Ping Ji; Hao Shen; Ying Wang; Huji XuFront Immunol2019Restored and Enhanced Memory T Cell Immunity in Rheumatoid Arthritis After TNFα Blocker Treatment.
31105686Paul V Lehmann; Maneewan Suwansaard; Ting Zhang; Diana R Roen; Greg A Kirchenbaum; Alexey Y Karulin; Alexander Lehmann; Pedro A RecheFront Immunol2019Comprehensive Evaluation of the Expressed CD8+ T Cell Epitope Space Using High-Throughput Epitope Mapping.
19864595Andrea Schub; Ingrid G Schuster; Wolfgang Hammerschmidt; Andreas MoosmannJ Immunol2009CMV-specific TCR-transgenic T cells for immunotherapy.
24711416Ivan V Zvyagin; Mikhail V Pogorelyy; Marina E Ivanova; Ekaterina A Komech; Mikhail Shugay; Dmitry A Bolotin; Andrey A Shelenkov; Alexey A Kurnosov; Dmitriy B Staroverov; Dmitriy M Chudakov; Yuri B Lebedev; Ilgar Z MamedovProc Natl Acad Sci U S A2014Distinctive properties of identical twins' TCR repertoires revealed by high-throughput sequencing.
24512815Dan Koning; Ana I Costa; Raiza Hasrat; Bart P X Grady; Sanne Spijkers; Nening Nanlohy; Can Keşmir; Debbie van BaarleJ Immunol Methods2014In vitro expansion of antigen-specific CD8(+) T cells distorts the T-cell repertoire.
23028307P L Klarenbeek; E B M Remmerswaal; I J M ten Berge; M E Doorenspleet; B D C van Schaik; R E E Esveldt; S D Koch; A ten Brinke; A H C van Kampen; F J Bemelman; P P Tak; F Baas; N de Vries; R A W van LierPLoS Pathog2012Deep sequencing of antiviral T-cell responses to HCMV and EBV in humans reveals a stable repertoire that is maintained for many years.
30783092Natasja Wulff Pedersen; Anja Holm; Nikolaj Pagh Kristensen; Anne-Mette Bjerregaard; Amalie Kai Bentzen; Andrea Marion Marquard; Tripti Tamhane; Kristoffer Sølvsten Burgdorf; Henrik Ullum; Poul Jennum; Stine Knudsen; Sine Reker Hadrup; Birgitte Rahbek KornumNat Commun2019CD8<sup>+</sup> T cells from patients with narcolepsy and healthy controls recognize hypocretin neuron-specific antigens.
31324690Sunil Kumar Saini; Tripti Tamhane; Raghavendra Anjanappa; Ankur Saikia; Sofie Ramskov; Marco Donia; Inge Marie Svane; Søren Nyboe Jakobsen; Maria Garcia-Alai; Martin Zacharias; Rob Meijers; Sebastian Springer; Sine Reker HadrupSci Immunol2019Empty peptide-receptive MHC class I molecules for efficient detection of antigen-specific T cells.
31398327Tomasz Kula; Mohammad H Dezfulian; Charlotte I Wang; Nouran S Abdelfattah; Zachary C Hartman; Kai W Wucherpfennig; Herbert Kim Lyerly; Stephen J ElledgeCell2019T-Scan: A Genome-wide Method for the Systematic Discovery of T Cell Epitopes.
31502632Alphonsus H C Ng; Songming Peng; Alexander M Xu; Won Jun Noh; Katherine Guo; Michael T Bethune; William Chour; Jongchan Choi; Sung Yang; David Baltimore; James R HeathLab Chip2019MATE-Seq: microfluidic antigen-TCR engagement sequencing.
31568490Benjamin Faist; Fabian Schlott; Christian Stemberger; Kevin M Dennehy; Angela Krackhardt; Mareike Verbeek; Götz U Grigoleit; Matthias Schiemann; Dieter Hoffmann; Andrea Dick; Klaus Martin; Martin Hildebrandt; Dirk H Busch; Michael NeuenhahnPLoS One2019Targeted in-vitro-stimulation reveals highly proliferative multi-virus-specific human central memory T cells as candidates for prophylactic T cell therapy.
31219185Michael D Keller; Sam Darko; Haili Lang; Amy Ransier; Christopher A Lazarski; Yunfei Wang; Patrick J Hanley; Blachy J Davila; Jennifer R Heimall; Richard F Ambinder; A John Barrett; Cliona M Rooney; Helen E Heslop; Daniel C Douek; Catherine M BollardBr J Haematol2019T-cell receptor sequencing demonstrates persistence of virus-specific T cells after antiviral immunotherapy.
31869419Maren Lübke; Stefanie Spalt; Daniel J Kowalewski; Cosima Zimmermann; Liane Bauersfeld; Annika Nelde; Leon Bichmann; Ana Marcu; Janet Kerstin Peper; Oliver Kohlbacher; Juliane S Walz; Vu Thuy Khanh Le-Trilling; Hartmut Hengel; Hans-Georg Rammensee; Stefan Stevanović; Anne HaleniusJ Exp Med2020Identification of HCMV-derived T cell epitopes in seropositive individuals through viral deletion models.
32140156Louise C Rowntree; Heleen van den Heuvel; Jessica Sun; Lloyd J D'Orsogna; Thi H O Nguyen; Frans H J Claas; Jamie Rossjohn; Tom C Kotsimbos; Anthony W Purcell; Nicole A MifsudFront Immunol2020Preferential HLA-B27 Allorecognition Displayed by Multiple Cross-Reactive Antiviral CD8<sup>+</sup> T Cell Receptors.
10x Genomics2020CD8+ T cells of Healthy Donors 1-4: Single Cell Immune Profiling Dataset by Cell Ranger 3.0.2
32042168David G Millar; Rakesh R Ramjiawan; Kosuke Kawaguchi; Nisha Gupta; Jiang Chen; Songfa Zhang; Takashi Nojiri; William W Ho; Shuichi Aoki; Keehoon Jung; Ivy Chen; Feng Shi; James M Heather; Kohei Shigeta; Laura T Morton; Sean Sepulveda; Li Wan; Ricky Joseph; Eleanor Minogue; Ashok Khatri; Aditya Bardia; Leif W Ellisen; Ryan B Corcoran; Aaron N Hata; Sara I Pai; Rakesh K Jain; Dai Fukumura; Dan G Duda; Mark CobboldNat Biotechnol2020Antibody-mediated delivery of viral epitopes to tumors harnesses CMV-specific T cells for cancer therapy.
31844290Siranush Sarkizova; Susan Klaeger; Phuong M Le; Letitia W Li; Giacomo Oliveira; Hasmik Keshishian; Christina R Hartigan; Wandi Zhang; David A Braun; Keith L Ligon; Pavan Bachireddy; Ioannis K Zervantonakis; Jennifer M Rosenbluth; Tamara Ouspenskaia; Travis Law; Sune Justesen; Jonathan Stevens; William J Lane; Thomas Eisenhaure; Guang Lan Zhang; Karl R Clauser; Nir Hacohen; Steven A Carr; Catherine J Wu; Derin B KeskinNat Biotechnol2020A large peptidome dataset improves HLA class I epitope prediction across most of the human population.
20200354Cécile Alanio; Fabrice Lemaitre; Helen K W Law; Milena Hasan; Matthew L AlbertBlood2010Enumeration of human antigen-specific naive CD8+ T cells reveals conserved precursor frequencies.
11984506Christine Benz; Olaf Utermöhlen; Anna Wulf; Brigitte Villmow; Volker Dries; Tobias Goeser; Ulrich Koszinowski; Dirk H BuschGastroenterology2002Activated virus-specific T cells are early indicators of anti-CMV immune reactions in liver transplant patients.
18619726Fei Fei; Yingzhe Yu; Anita Schmitt; Markus Thomas Rojewski; Baoan Chen; Jochen Greiner; Marlies Götz; Philippe Guillaume; Hartmut Döhner; Donald Bunjes; Michael SchmittExp Hematol2008Dasatinib exerts an immunosuppressive effect on CD8+ T cells specific for viral and leukemia antigens.
32184297Ron S Gejman; Heather F Jones; Martin G Klatt; Aaron Y Chang; Claire Y Oh; Smita S Chandran; Tatiana Korontsvit; Viktoriya Zakahleva; Tao Dao; Christopher A Klebanoff; David A ScheinbergCancer Immunol Res2020Identification of the Targets of T-cell Receptor Therapeutic Agents and Cells by Use of a High-Throughput Genetic Platform.
32393905Matthew J Spindler; Ayla L Nelson; Ellen K Wagner; Natasha Oppermans; John S Bridgeman; James M Heather; Adam S Adler; Michael A Asensio; Robert C Edgar; Yoong Wearn Lim; Everett H Meyer; Robert E Hawkins; Mark Cobbold; David S JohnsonNat Biotechnol2020Massively parallel interrogation and mining of natively paired human TCRαβ repertoires.
29895573Ludmila Danilova; Valsamo Anagnostou; Justina X Caushi; John-William Sidhom; Haidan Guo; Hok Yee Chan; Prerna Suri; Ada Tam; Jiajia Zhang; Margueritta El Asmar; Kristen A Marrone; Jarushka Naidoo; Julie R Brahmer; Patrick M Forde; Alexander S Baras; Leslie Cope; Victor E Velculescu; Drew M Pardoll; Franck Housseau; Kellie N SmithCancer Immunol Res2018The Mutation-Associated Neoantigen Functional Expansion of Specific T Cells (MANAFEST) Assay: A Sensitive Platform for Monitoring Antitumor Immunity.
32594746John W Hickey; Ariel Isser; Sebastian F Salathe; Kayla M Gee; Meng-Hsuan Hsiao; Wasamah Shaikh; Nkechi C Uzoukwu; Joan Glick Bieler; Hai-Quan Mao; Jonathan P SchneckNano Lett2020Adaptive Nanoparticle Platforms for High Throughput Expansion and Detection of Antigen-Specific T cells.
32812325Elena Perpiñán; Sofía Pérez-Del-Pulgar; María-Carlota Londoño; Zoe Mariño; Sabela Lens; Thais Leonel; Concepción Bartres; Mireia García-López; Sergio Rodriguez-Tajes; Xavier Forns; George KoutsoudakisJ Viral Hepat2020Chronic genotype 1 hepatitis C along with cirrhosis drives a persistent imprint in virus-specific CD8<sup>+</sup> T cells after direct-acting antiviral therapies.
27198675Erlend Strønen; Mireille Toebes; Sander Kelderman; Marit M van Buuren; Weiwen Yang; Nienke van Rooij; Marco Donia; Maxi-Lu Böschen; Fridtjof Lund-Johansen; Johanna Olweus; Ton N SchumacherScience2016Targeting of cancer neoantigens with donor-derived T cell receptor repertoires.
33125463Laura R E Becher; Wendy K Nevala; Shari Lee Sutor; Megan Abergel; Michele M Hoffmann; Christopher A Parks; Larry R Pease; Adam G Schrum; Svetomir N Markovic; Diana GilBlood Adv2020Public and private human T-cell clones respond differentially to HCMV antigen when boosted by CD3 copotentiation.
33159402Ilenia Pacella; Ilenia Cammarata; Carmela Martire; Giuseppina Brancaccio; Giovanni Battista Gaeta; Vincenzo Barnaba; Silvia PiconeseLiver Int2021CD8<sup>+</sup> T cells specific to apoptosis-associated epitopes are expanded in patients with chronic HBV infection and fibrosis.
33281829Saskia Schmitt; Siret Tahk; Alina Lohner; Gerulf Hänel; Andreas Maiser; Martina Hauke; Lubna Patel; Maurine Rothe; Christine Josenhans; Heinrich Leonhardt; Marieke Griffioen; Katrin Deiser; Nadja C Fenn; Karl-Peter Hopfner; Marion SubkleweFront Immunol2020Fusion of Bacterial Flagellin to a Dendritic Cell-Targeting αCD40 Antibody Construct Coupled With Viral or Leukemia-Specific Antigens Enhances Dendritic Cell Maturation and Activates Peptide-Responsive T Cells.
33329532Emma C Materne; Daniele Lilleri; Francesca Garofoli; Giuseppina Lombardi; Milena Furione; Maurizio Zavattoni; Laura GibsonFront Immunol2020Cytomegalovirus-Specific T Cell Epitope Recognition in Congenital Cytomegalovirus Mother-Infant Pairs.
33338412Min-Seok Rha; Hye Won Jeong; Jae-Hoon Ko; Seong Jin Choi; In-Ho Seo; Jeong Seok Lee; Moa Sa; A Reum Kim; Eun-Jeong Joo; Jin Young Ahn; Jung Ho Kim; Kyoung-Ho Song; Eu Suk Kim; Dong Hyun Oh; Mi Young Ahn; Hee Kyoung Choi; Ji Hoon Jeon; Jae-Phil Choi; Hong Bin Kim; Young Keun Kim; Su-Hyung Park; Won Suk Choi; Jun Yong Choi; Kyong Ran Peck; Eui-Cheol ShinImmunity2021PD-1-Expressing SARS-CoV-2-Specific CD8<sup>+</sup> T Cells Are Not Exhausted, but Functional in Patients with COVID-19.
33427749Hassen Kared; Andrew D Redd; Evan M Bloch; Tania S Bonny; Hermi Sumatoh; Faris Kairi; Daniel Carbajo; Brian Abel; Evan W Newell; Maria P Bettinotti; Sarah E Benner; Eshan U Patel; Kirsten Littlefield; Oliver Laeyendecker; Shmuel Shoham; David Sullivan; Arturo Casadevall; Andrew Pekosz; Alessandra Nardin; Michael Fehlings; Aaron Ar Tobian; Thomas C QuinnJ Clin Invest2021SARS-CoV-2-specific CD8+ T cell responses in convalescent COVID-19 individuals.
33853928Sunil Kumar Saini; Ditte Stampe Hersby; Tripti Tamhane; Helle Rus Povlsen; Susana Patricia Amaya Hernandez; Morten Nielsen; Anne Ortved Gang; Sine Reker HadrupSci Immunol2021SARS-CoV-2 genome-wide T cell epitope mapping reveals immunodominance and substantial CD8<sup>+</sup> T cell activation in COVID-19 patients.
33483338Mark N Lee; Matthew MeyersonSci Immunol2021Antigen identification for HLA class I- and HLA class II-restricted T cell receptors using cytokine-capturing antigen-presenting cells.
33414250Teresa Rodriguez-Calvo; Lars Krogvold; Natalie Amirian; Knut Dahl-Jørgensen; Matthias von HerrathDiabetes2021One in Ten CD8<sup>+</sup> Cells in the Pancreas of Living Individuals With Recent-Onset Type 1 Diabetes Recognizes the Preproinsulin Epitope PPI<sub>15-24</sub>.
33652936Se-Young Lee; Deok-Han Ko; Min-Jeong Son; Jeong-Ah Kim; Keunok Jung; Yong-Sung KimInt J Mol Sci2021Affinity Maturation of a T-Cell Receptor-Like Antibody Specific for a Cytomegalovirus pp65-Derived Peptide Presented by HLA-A*02:01.
33665637Julien Schmidt; Angela R Smith; Morgane Magnin; Julien Racle; Jason R Devlin; Sara Bobisse; Julien Cesbron; Victor Bonnet; Santiago J Carmona; Florian Huber; Giovanni Ciriello; Daniel E Speiser; Michal Bassani-Sternberg; George Coukos; Brian M Baker; Alexandre Harari; David GfellerCell Rep Med2021Prediction of neo-epitope immunogenicity reveals TCR recognition determinants and provides insight into immunoediting.
33151741S-U Hwang; J-H Lee; S-Y Choi; Y-T Lee; S-Y Park; H S Lee; J W Jae; N-Ch Jung; Y Wang; D-S LimActa Virol2020A simple and efficient method of generating HCMV pp65-specific T cells using overlapping peptides.
33633736Alexander A Lehmann; Ting Zhang; Pedro A Reche; Paul V LehmannFront Immunol2020Discordance Between the Predicted Versus the Actually Recognized CD8+ T Cell Epitopes of HCMV pp65 Antigen and Aleatory Epitope Dominance.
34210785Vamsee Mallajosyula; Conner Ganjavi; Saborni Chakraborty; Alana M McSween; Ana Jimena Pavlovitch-Bedzyk; Julie Wilhelmy; Allison Nau; Monali Manohar; Kari C Nadeau; Mark M DavisSci Immunol2021CD8<sup>+</sup> T cells specific for conserved coronavirus epitopes correlate with milder disease in COVID-19 patients.
34341170Sabrina Mazouz; Maude Boisvert; Mohamed S Abdel-Hakeem; Omar Khedr; Julie Bruneau; Naglaa H ShoukryJ Immunol2021Expansion of Unique Hepatitis C Virus-Specific Public CD8<sup>+</sup> T Cell Clonotypes during Acute Infection and Reinfection.
35008688Amélie Rousselière; Laurence Delbos; Céline Bressollette; Maïlys Berthaume; Béatrice CharreauInt J Mol Sci2021Mapping and Characterization of HCMV-Specific Unconventional HLA-E-Restricted CD8 T Cell Populations and Associated NK and T Cell Responses Using HLA/Peptide Tetramers and Spectral Flow Cytometry.
35162953Lukas Bunse; Claudia Sommerer; Chin Leng Tan; Felix Korell; Anita Schmitt; Angela Hückelhoven-Krauss; Brigitte Neuber; Thomas Mertens; Michael Platten; Edward W Green; Martin Zeier; Michael SchmittInt J Mol Sci2022Common T-Cell-Receptor Motifs and Features in Patients with Cytomegalovirus (CMV)-Seronegative End-Stage Renal Disease Receiving a Peptide Vaccination against CMV.
34793243Joshua M Francis; Del Leistritz-Edwards; Augustine Dunn; Christina Tarr; Jesse Lehman; Conor Dempsey; Andrew Hamel; Violeta Rayon; Gang Liu; Yuntong Wang; Marcos Wille; Melissa Durkin; Kane Hadley; Aswathy Sheena; Benjamin Roscoe; Mark Ng; Graham Rockwell; Margaret Manto; Elizabeth Gienger; Joshua Nickerson; MGH COVID-19 Collection and Processing Team; Amir Moarefi; Michael Noble; Thomas Malia; Philip D Bardwell; William Gordon; Joanna Swain; Mojca Skoberne; Karsten Sauer; Tim Harris; Ananda W Goldrath; Alex K Shalek; Anthony J Coyle; Christophe Benoist; Daniel C PregibonSci Immunol2022Allelic variation in class I HLA determines CD8<sup>+</sup> T cell repertoire shape and cross-reactive memory responses to SARS-CoV-2.
34025665Sara P H van den Berg; Josien Lanfermeijer; Ronald H J Jacobi; Marion Hendriks; Martijn Vos; Roos van Schuijlenburg; Nening M Nanlohy; José A M Borghans; Josine van Beek; Debbie van Baarle; Jelle de WitFront Immunol2021Latent CMV Infection Is Associated With Lower Influenza Virus-Specific Memory T-Cell Frequencies, but Not With an Impaired T-Cell Response to Acute Influenza Virus Infection.
35589842Marta Łuksza; Zachary M Sethna; Luis A Rojas; Jayon Lihm; Barbara Bravi; Yuval Elhanati; Kevin Soares; Masataka Amisaki; Anton Dobrin; David Hoyos; Pablo Guasp; Abderezak Zebboudj; Rebecca Yu; Adrienne Kaya Chandra; Theresa Waters; Zagaa Odgerel; Joanne Leung; Rajya Kappagantula; Alvin Makohon-Moore; Amber Johns; Anthony Gill; Mathieu Gigoux; Jedd Wolchok; Taha Merghoub; Michel Sadelain; Erin Patterson; Remi Monasson; Thierry Mora; Aleksandra M Walczak; Simona Cocco; Christine Iacobuzio-Donahue; Benjamin D Greenbaum; Vinod P BalachandranNature2022Neoantigen quality predicts immunoediting in survivors of pancreatic cancer.
35632543Hong-Seon Pyo; Cheol-Hwa Hong; Haeyoun Choi; In-Cheol Baek; Tai-Gyu KimVaccines (Basel)2022Identification of Naturally Processed Epitope Region Using Artificial APC Expressing a Single HLA Class I Allotype and mRNA of HCMV pp65 Antigen Fragments.
35737741Vijayendra Dasari; Kirrilee Beckett; Shane Horsefield; George Ambalathingal; Rajiv KhannaPLoS Pathog2022A bivalent CMV vaccine formulated with human compatible TLR9 agonist CpG1018 elicits potent cellular and humoral immunity in HLA expressing mice.
35798752Yueyang Sun; Lu Yan; Jiajia Sun; Mingshu Xiao; Wei Lai; Guangqi Song; Li Li; Chunhai Fan; Hao PeiNat Commun2022Nanoscale organization of two-dimensional multimeric pMHC reagents with DNA origami for CD8<sup>+</sup> T cell detection.
12782677Arnaud Marchant; Victor Appay; Marianne Van Der Sande; Nicolas Dulphy; Corinne Liesnard; Michael Kidd; Steve Kaye; Olubukola Ojuola; Geraldine M A Gillespie; Ana L Vargas Cuero; Vincenzo Cerundolo; Margaret Callan; Keith P W J McAdam; Sarah L Rowland-Jones; Catherine Donner; Andrew J McMichael; Hilton WhittleJ Clin Invest2003Mature CD8(+) T lymphocyte response to viral infection during fetal life.
35605246Aisha N Hasan; Ekaterina Doubrovina; Rosa Sottile; Susan Prockop; Martin G Klatt; Glenn Heller; Annamalai Selvakumar; Lorna Barnett; Katharine C Hsu; Richard J O'ReillyBlood Adv2022Dominant epitopes presented by prevalent HLA alleles permit wide use of banked CMVpp65 T cells in adoptive therapy.
36054234Guangna Liu; Hua Chen; Xingyu Cao; Lemei Jia; Wei Rui; Hongli Zheng; Daosheng Huang; Fang Liu; Yue Liu; Xueqiang Zhao; Peihua Lu; Xin LinAm J Hematol2022Efficacy of pp65-specific TCR-T cell therapy in treating cytomegalovirus infection after hematopoietic stem cell transplantation.
36279715Kamalakannan Rajasekaran; Xiangnan Guan; Alireza Tafazzol; Habib Hamidi; Martine Darwish; Mahesh YadavTransl Oncol2023Tetramer-aided sorting and single-cell RNA sequencing facilitate transcriptional profiling of antigen-specific CD8+ T cells.
36466875Cheol-Hwa Hong; Hong-Seon Pyo; In-Cheol Baek; Tai-Gyu KimFront Immunol2022Rapid identification of CMV-specific TCRs via reverse TCR cloning system based on bulk TCR repertoire data.
36532017Amélie Rousselière; Nathalie Gérard; Laurence Delbos; Pierrick Guérif; Magali Giral; Céline Bressollette-Bodin; Béatrice CharreauFront Immunol2022Distinctive phenotype for HLA-E- versus HLA-A2-restricted memory CD8 αβT cells in the course of HCMV infection discloses features shared with NKG2C<sup>+</sup>CD57<sup>+</sup>NK and δ2<sup>-</sup>γδT cell subsets.
36980230Amélie Rousselière; Béatrice CharreauCells2023Persistent CD8 T Cell Marks Caused by the HCMV Infection in Seropositive Adults: Prevalence of HLA-E-Reactive CD8 T Cells.
36121440W Huisman; M C J Roex; L Hageman; E A S Koster; S A J Veld; C Hoogstraten; P van Balen; H M van Egmond; C A M van Bergen; H Einsele; L Germeroth; D Amsen; J H F Falkenburg; I JedemaBlood Adv2023Tracking the progeny of adoptively transferred virus-specific T cells in patients posttransplant using TCR sequencing.
37261346Willemijn van der Wulp; Anna M Gram; Boris Bleijlevens; Renate S Hagedoorn; Can Araman; Robbert Q Kim; Jan Wouter Drijfhout; Paul W H I Parren; Richard G Hibbert; Rob C Hoeben; Sander I van Kasteren; Janine Schuurman; Maaike E Ressing; Mirjam H M HeemskerkFront Immunol2023Comparison of methods generating antibody-epitope conjugates for targeting cancer with virus-specific T cells.
37193826William Chour; Jongchan Choi; Jingyi Xie; Mary E Chaffee; Thomas M Schmitt; Kathryn Finton; Diana C DeLucia; Alexander M Xu; Yapeng Su; Daniel G Chen; Rongyu Zhang; Dan Yuan; Sunga Hong; Alphonsus H C Ng; Jonah Z Butler; Rick A Edmark; Lesley C Jones; Kim M Murray; Songming Peng; Guideng Li; Roland K Strong; John K Lee; Jason D Goldman; Philip D Greenberg; James R HeathCommun Biol2023Large libraries of single-chain trimer peptide-MHCs enable antigen-specific CD8+ T cell discovery and analysis.
31941832Minsuk Kwon; Chang Gon Kim; Hoyoung Lee; Hyunsoo Cho; Youngun Kim; Eung Chang Lee; Seong Jin Choi; Junsik Park; In-Ho Seo; Bjarne Bogen; Ik-Chan Song; Deog-Yeon Jo; Jin Seok Kim; Su-Hyung Park; Inhak Choi; Yoon Seok Choi; Eui-Cheol ShinClin Cancer Res2020PD-1 Blockade Reinvigorates Bone Marrow CD8<sup>+</sup> T Cells from Patients with Multiple Myeloma in the Presence of TGFβ Inhibitors.
32299815Shiao-Pei Weathers; Marta Penas-Prado; Be-Lian Pei; Xiaoyang Ling; Cynthia Kassab; Pinaki Banerjee; Mustafa Bdiwi; Hila Shaim; Abdullah Alsuliman; Mayra Shanley; John F de Groot; Barbara J O'Brien; Rebecca Harrison; Nazanin Majd; Carlos Kamiya-Matsuoka; Gregory N Fuller; Jason T Huse; Linda Chi; Ganesh Rao; Jeffrey S Weinberg; Frederick F Lang; Raymond Sawaya; Elizabeth J Shpall; Katayoun Rezvani; Amy B HeimbergerClin Cancer Res2020Glioblastoma-mediated Immune Dysfunction Limits CMV-specific T Cells and Therapeutic Responses: Results from a Phase I/II Trial.
37586765Siri Amanda Tvingsholm; Marcus Svensson Frej; Vibeke Mindahl Rafa; Ulla Kring Hansen; Maria Ormhøj; Alexander Tyron; Agnete W P Jensen; Mohammad Kadivar; Amalie Kai Bentzen; Kamilla K Munk; Gitte N Aasbjerg; Jeppe S H Ternander; Christina Heeke; Tripti Tamhane; Christian Schmess; Samuel A Funt; Julie Westerlin Kjeldsen; Anders Handrup Kverneland; Özcan Met; Arianna Draghi; Søren Nyboe Jakobsen; Marco Donia; Inge Marie Svane; Sine Reker HadrupJ Immunother Cancer2023TCR-engaging scaffolds selectively expand antigen-specific T-cells with a favorable phenotype for adoptive cell therapy.
37280206Julien Schmidt; Johanna Chiffelle; Marta A S Perez; Morgane Magnin; Sara Bobisse; Marion Arnaud; Raphael Genolet; Julien Cesbron; David Barras; Blanca Navarro Rodrigo; Fabrizio Benedetti; Alexandra Michel; Lise Queiroz; Petra Baumgaertner; Philippe Guillaume; Michael Hebeisen; Olivier Michielin; Tu Nguyen-Ngoc; Florian Huber; Melita Irving; Stéphanie Tissot-Renaud; Brian J Stevenson; Sylvie Rusakiewicz; Denarda Dangaj Laniti; Michal Bassani-Sternberg; Nathalie Rufer; David Gfeller; Lana E Kandalaft; Daniel E Speiser; Vincent Zoete; George Coukos; Alexandre HarariNat Commun2023Neoantigen-specific CD8 T cells with high structural avidity preferentially reside in and eliminate tumors.
37761976Eunjung Cho; Seongeun Han; Hyeon Seok Eom; Sang-Jin Lee; Chungyong Han; Rohit Singh; Seon-Hee Kim; Bo-Mi Park; Byoung-Gie Kim; Young H Kim; Byoung S Kwon; Ki Taek Nam; Beom K ChoiInt J Mol Sci2023Cross-Activation of Regulatory T Cells by Self Antigens Limits Self-Reactive and Activated CD8<sup>+</sup> T Cell Responses.
35401538Wesley Huisman; Lois Hageman; Didier A T Leboux; Alexandra Khmelevskaya; Grigory A Efimov; Marthe C J Roex; Derk Amsen; J H Frederik Falkenburg; Inge JedemaFront Immunol2022Public T-Cell Receptors (TCRs) Revisited by Analysis of the Magnitude of Identical and Highly-Similar TCRs in Virus-Specific T-Cell Repertoires of Healthy Individuals.
37751288Daphne M Hullegie-Peelen; Hector Tejeda Mora; Dennis A Hesselink; Eric Mj Bindels; Thierry Pp van den Bosch; Marian C Clahsen-van Groningen; Marjolein Dieterich; Sebastiaan Heidt; Robert C Minnee; Georges Mgm Verjans; Martin J Hoogduijn; Carla C BaanJCI Insight2023Virus-specific TRM cells of both donor and recipient origin reside in human kidney transplants.
37974400Lianghua Shen; Jiali Yang; Chijian Zuo; Jian Xu; Ling Ma; Qiaomei He; Xiao Zhou; Xiaodan Ding; Lixiang Wei; Suqin Jiang; Luanluan Ma; Benjia Zhang; Yuqin Yang; Baoxia Dong; Liping Wan; Xueying Ding; Ming Zhu; Zhenhua Sun; Pengran Wang; Xianmin Song; Yan ZhangMol Ther2024Circular mRNA-based TCR-T offers a safe and effective therapeutic strategy for treatment of cytomegalovirus infection.
38053994Barbara Couturaud; Bastien Doix; Laura Carretero-Iglesia; Mathilde Allard; Sylvain Pradervand; Michael Hebeisen; Nathalie RuferFront Immunol2023Overall avidity declines in TCR repertoires during latent CMV but not EBV infection.
37886042Ana C Maretti-Mira; Matthew P Salomon; Angela M Hsu; Chikako Matsuba; Lucy Golden-MasonFront Virol2023Chronic HCV infection promotes cytotoxicity in antigen-specific CD8<sup>+</sup> T cells regardless of virus specificity.
38377192Cosima Zimmermann; Gabrielle M Watson; Liane Bauersfeld; Richard Berry; Barbara Ciblis; Huan Lan; Carolin Gerke; Valerie Oberhardt; Jonas Fuchs; Maike Hofmann; Christian Freund; Jamie Rossjohn; Frank Momburg; Hartmut Hengel; Anne HaleniusProc Natl Acad Sci U S A2024Diverse cytomegalovirus US11 antagonism and MHC-A evasion strategies reveal a tit-for-tat coevolutionary arms race in hominids.
31624377Marthe C J Roex; Peter van Balen; Lothar Germeroth; Lois Hageman; Esther van Egmond; Sabrina A J Veld; Conny Hoogstraten; Ellis van Liempt; Jaap J Zwaginga; Liesbeth C de Wreede; Pauline Meij; Ann C T M Vossen; Sophia Danhof; Hermann Einsele; M Ron Schaafsma; Hendrik Veelken; Constantijn J M Halkes; Inge Jedema; J H Frederik FalkenburgLeukemia2020Generation and infusion of multi-antigen-specific T cells to prevent complications early after T-cell depleted allogeneic stem cell transplantation-a phase I/II study.
38608022Nikolaj Pagh Kristensen; Edoardo Dionisio; Amalie Kai Bentzen; Tripti Tamhane; Janine Sophie Kemming; Grigorii Nos; Lasse Frank Voss; Ulla Kring Hansen; Georg Michael Lauer; Sine Reker HadrupSci Adv2024Simultaneous analysis of pMHC binding and reactivity unveils virus-specific CD8 T cell immunity to a concise epitope set.
38782542Sofie Kirial Mørk; Signe Koggersbøl Skadborg; Benedetta Albieri; Arianna Draghi; Kalijn Bol; Mohammad Kadivar; Marie Christine Wulff Westergaard; Joachim Stoltenborg Granhøj; Annie Borch; Nadia Viborg Petersen; Nikolas Thuesen; Ida Svahn Rasmussen; Lars Vibe Andreasen; Rebecca Bach Dohn; Christina Westmose Yde; Nis Noergaard; Torben Lorentzen; Anders Bundgaard Soerensen; Daniela Kleine-Kohlbrecher; Anders Jespersen; Dennis Christensen; Jens Kringelum; Marco Donia; Sine Reker Hadrup; Inge Marie SvaneJ Immunother Cancer2024Dose escalation study of a personalized peptide-based neoantigen vaccine (EVX-01) in patients with metastatic melanoma.
39433089Weiwen Zhang; Fernanda M Roversi; Anna B Morris; Kristina Ortiz; Grace Zhou; Annette Hadley; Xueqiong Zhang; Juliete A F Silva; Cynthia P Breeden; Zhuldyz Zhanzak; Haydn T Kissick; Christian P LarsenAm J Transplant2024Major histocompatibility complex and peptide specificity underpin CD8<sup>+</sup> T cell direct alloresponse.
23143746Daisuke Nobuoka; Toshiaki Yoshikawa; Mari Takahashi; Tatsuaki Iwama; Kazutaka Horie; Manami Shimomura; Shiro Suzuki; Noriko Sakemura; Munehide Nakatsugawa; Hiroshi Sadamori; Takahito Yagi; Toshiyoshi Fujiwara; Tetsuya NakatsuraCancer Immunol Immunother2013Intratumoral peptide injection enhances tumor cell antigenicity recognized by cytotoxic T lymphocytes: a potential option for improvement in antigen-specific cancer immunotherapy.
37133356Helle Rus Povlsen; Amalie Kai Bentzen; Mohammad Kadivar; Leon Eyrich Jessen; Sine Reker Hadrup; Morten NielsenElife2023Improved T cell receptor antigen pairing through data-driven filtering of sequencing information from single cells.
25245536Petra Simon; Tana A Omokoko; Andrea Breitkreuz; Lisa Hebich; Sebastian Kreiter; Sebastian Attig; Abdo Konur; Cedrik M Britten; Claudia Paret; Karl Dhaene; Özlem Türeci; Ugur SahinCancer Immunol Res2014Functional TCR retrieval from single antigen-specific human T cells reveals multiple novel epitopes.

Views: 35